KEGG   Rhodospirillum centenum: RC1_1650Help
Entry
RC1_1650          CDS       T00785                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rce  Rhodospirillum centenum
Pathway
rce00340  Histidine metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RC1_1650 (hisD)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RC1_1650 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACI99051
UniProt: B6INF4
Position
complement(1698762..1700063)
Genome map
AA seq 433 aa AA seqDB search
MPLRLSTRDPGFEAGFATLLAAKREVQEDVNAAVATVLADVRAHGDTAVIGYTRRWDRQD
LTPETLRITAAEIDAAVARCDAGTLAALHEAAARIEAFHRRQQPEALSFTDAQGVRLGAR
WTPVGAVGIYVPGGTAAYPSSVLMNAMPARVAGVPRIAMVVPTPDGVLNPLVLAAARAAG
VTEIYRIGGAQAVAALAYGTDTIAPVDKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEIL
VVADGANDPAWIAADLLSQAEHDESSQAILLTDDAAFADAVAAAVEAHLATLPRARIAAA
SWQAHGAIVVLRDLAEAPALVDRLAPEHLELAVADPDALAARVRNAGAIFLGRHTPEAIG
DYVAGPNHVLPTARSARFSSGLNVLDFMKRTTLVGCDACSLAAIGPAAVTLARAEGLEAH
ALSVAIRLGRAAE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttaggctctccacccgcgatcccggcttcgaggccggtttcgccaccctgctc
gccgccaagcgcgaggtgcaggaggatgtgaacgccgccgtcgccacggtcctggccgac
gtgcgggcgcatggcgacacggcggtgatcgggtacacgcggcgctgggaccggcaggac
ctgacgccggagacgctgcgcatcaccgcggcggagatcgacgccgccgtcgcccgctgc
gatgccggcaccctggccgccctgcacgaggccgcggcgcggatcgaggcgttccaccgc
cgccagcagccggaggcgctgtccttcaccgatgcgcagggtgtgcgcctgggcgcgcgc
tggacgccggtgggcgccgtcggcatctacgttcccggcggcacggcggcctatcccagt
tccgtcctgatgaacgccatgccggcgcgcgtcgcgggcgtgccgcgcatcgccatggtg
gtgccgactcccgacggcgtgctgaacccgctggtgctggccgccgcgcgggcggcgggg
gtgacggagatctaccggatcggcggggcccaggccgtggcggcgctcgcctacggcacg
gacaccatcgccccggtggacaagatcgtcggccccggcaacgcctatgtcgccgccgcc
aagcggcaggtcttcggcaccgtcggcatcgacatgatcgccggcccgtcggagatcctg
gtggtcgccgatggtgcgaacgatcccgcctggatcgccgccgacctgctctcgcaggcg
gagcacgacgaaagctcccaggccatcctgctgaccgacgacgcggccttcgcggatgcc
gtcgcggcggcggtggaggcgcatctggcaaccctgccgcgggcccgcatcgcggcggca
agctggcaggcgcacggcgccatcgtcgtgctgcgcgatctggcggaggcgccggccctg
gtggaccggctggcgccggagcatctggaactggccgtggccgatcccgacgcgctggcc
gcgcgtgtccgcaacgcgggcgccatcttcctgggccgccacacgcccgaggccatcggc
gattatgtggccgggccgaaccatgtgctgccgaccgcgcgcagcgcgcgtttctccagc
gggctgaacgtgctggacttcatgaagcggacgacgctggtcggctgcgacgcctgcagt
ttggccgccatcggcccggccgcggtgacgctggcgcgggccgaggggctggaggcgcac
gccctgtcggtggcgatccgtctcggccgcgccgcggagtag

DBGET integrated database retrieval system