KEGG   Rhodospirillum centenum: RC1_1720Help
Entry
RC1_1720          CDS       T00785                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
rce  Rhodospirillum centenum
Pathway
rce00230  Purine metabolism
rce00250  Alanine, aspartate and glutamate metabolism
rce01100  Metabolic pathways
Module
rce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RC1_1720 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RC1_1720 (purA)
Enzymes [BR:rce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     RC1_1720 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ACI99118
UniProt: B6ITA0
Position
1768842..1770134
Genome map
AA seq 430 aa AA seqDB search
MANVAVVGSQWGDEGKGKIVDWLSSRADVVVRFQGGHNAGHTLVIGDVEYKLSLLPSGVV
RPGKLSVIGNGVVVDPWALLREIDTIRAKGVTVTPETLLVAENCALILPLHGAVDRAREE
ARGASKIGTTGRGIGPAYEDKVARRAIRLCDLADDRVLEDKVDHLLFHHNALLRGLGAAE
IDKAELMAQIAEVAPRILPYAAVVWQRLDEAKRARKRILFEGAQGAMLDVDHGTYPFVTS
SNTVAGNAAAGSGMGPGVVGYVLGITKAYTTRVGSGPFPTELTDATGEQLGLRGREFGTV
TGRKRRCGWFDAVMVRQAIKTGGITGIALTKLDVLDGFSELKVCTGYRYQGEIIHHLPAG
QTAQAAVEPVYETFQGWSESTRGARSWADLPATAVKYVRRIEELVEAPVTLLSTSPERDD
TILMRDPFED
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtggcggtcgtcgggtcccagtggggcgatgagggcaagggcaagatcgtc
gactggctgtcctcgcgggccgatgtcgtggtccgcttccagggcggccacaatgccggc
cacacgctggtgatcggcgatgtcgagtacaagctgtctctgctgccctcgggcgtggtg
cgtccgggcaagctgtcggtgatcggcaacggcgtcgtcgtcgatccctgggctctgctg
cgggagatcgacacgatccgcgccaagggcgtgacggtgacgccggagaccctgctggtg
gcggagaactgcgccctgatcctgcccctgcacggggcggtggaccgggcgcgggaggag
gcgcgcggcgcctcgaagatcggcaccaccggccgcggcatcggcccggcctacgaggac
aaggtggcccgccgcgccatccgcctgtgcgatctggccgacgaccgggtgctggaggac
aaggttgaccatctgctgttccaccacaacgcgctgctgcgcgggctgggggcggcagag
atcgacaaggccgagctgatggcccagatcgcggaggtggcgccgcgcatcctgccctac
gccgcggtcgtctggcagcgcctggacgaggcgaagcgggcgcgcaagcgcatcctgttc
gagggcgcccagggcgccatgctggacgtggaccacggcacctatccgttcgtcaccagc
tccaacaccgtggccggcaacgccgccgccggcagcggcatggggccgggggtggtcggc
tatgtgctgggcatcaccaaggcctacaccacccgcgtcggctccggcccgttcccgacc
gagctgacggacgccaccggcgagcagctcggcctgcgcggccgcgagttcggcaccgtc
accgggcgcaagcgccgctgcggctggttcgacgccgtcatggtgcgtcaggcgatcaag
accggcggcatcaccggcatcgcgctcaccaagctggacgtgctggacggcttctccgag
ctgaaggtctgcaccggctaccgctatcagggggagatcatccaccacctgccggccgga
cagaccgcacaggcggccgtggagccggtctacgagaccttccagggctggagcgagagc
acccgcggcgcgcggtcctgggccgacctgccggcgacggcggtgaagtatgtccgccgc
atcgaggagctggtggaggcgccggtcaccctgctgtccaccagcccggagcgcgacgac
acgatcctgatgcgcgatccgttcgaggactga

DBGET integrated database retrieval system