KEGG   Rhodospirillum centenum: RC1_1744Help
Entry
RC1_1744          CDS       T00785                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rce  Rhodospirillum centenum
Pathway
rce00071  Fatty acid degradation
rce00072  Synthesis and degradation of ketone bodies
rce00280  Valine, leucine and isoleucine degradation
rce00310  Lysine degradation
rce00362  Benzoate degradation
rce00380  Tryptophan metabolism
rce00620  Pyruvate metabolism
rce00630  Glyoxylate and dicarboxylate metabolism
rce00640  Propanoate metabolism
rce00650  Butanoate metabolism
rce00900  Terpenoid backbone biosynthesis
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
rce01212  Fatty acid metabolism
rce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RC1_1744 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_1744 (fadA)
   00640 Propanoate metabolism
    RC1_1744 (fadA)
   00650 Butanoate metabolism
    RC1_1744 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RC1_1744 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RC1_1744 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RC1_1744 (fadA)
   00310 Lysine degradation
    RC1_1744 (fadA)
   00380 Tryptophan metabolism
    RC1_1744 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RC1_1744 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RC1_1744 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RC1_1744 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rce04147]
    RC1_1744 (fadA)
Enzymes [BR:rce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RC1_1744 (fadA)
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC1_1744 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACI99141
UniProt: B6ITC3
Position
complement(1793931..1795139)
Genome map
AA seq 402 aa AA seqDB search
MPDAYIYDHVRTPRGKGKKDGSLHEITPIQLATQVLAGLRDRNGLDTAVVDDVILGCVMP
VGEQGSNIARVAAINADFDETVAGVQINRFCASGLEAVNMAASKVMSGQSDMTIGGGVES
MSRVPMGSDGGAWPTDPAVAIRTYFVPQGISADLIATRYGFSRDDVDAYAVESQKRAARA
WAEGRFDRSVLPVKDVLGMPVLEKDETVRPDTTMQTLAALNPSFTEIGANYGYDAVAIQK
YPQVERINHIHHAGNSSGIVDGSAGVLIGSKEIGERLGLKPRARIRSFASIGSEPTIMLT
GPSFSAEKALKRAGMTKDDIDLWELNEAFASVVLRFMQALDIDHDSINVNGGAIAMGHPL
GATGAMILGILLDEMERRDLETGLATLCVGAGMGTATIVERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgcctatatctacgaccatgtccgcacgccccgcggcaagggcaagaaggac
gggtcgctgcacgagatcacgccgatccagctcgccacccaggtgctggcgggactgcgc
gaccgcaacgggctggacaccgccgtggtggacgacgtcatcctgggctgcgtgatgccg
gtgggcgagcagggcagcaacatcgcccgcgtcgccgccatcaatgccgacttcgacgag
acggtggccggggtccagatcaaccgcttctgcgcctcgggcctggaggcggtgaacatg
gccgcgtccaaggtcatgtccggccagtccgacatgaccatcggcggcggggtggagagc
atgagccgcgtgcccatgggctccgacggcggcgcctggccgaccgatccggctgtcgcc
atccgcacctacttcgtgccgcagggcatctccgccgacctgatcgccaccaggtacggc
ttcagccgcgacgacgtggacgcctatgcggtggagagccagaagcgcgccgcccgcgcc
tgggcggaaggccgcttcgaccgctccgtgctgccggtgaaggatgtcctcggcatgccc
gtgctggagaaggacgagacggttcggcccgacaccacgatgcagacgctggccgccctc
aacccgtccttcacggagatcggggcgaattacggctacgacgccgtggccatccagaag
tatccgcaggtggagcggatcaaccacatccaccatgccggcaacagctcgggcatcgtg
gacggctcggccggtgtgctgatcggcagcaaggagatcggggagcgcctggggctcaag
ccgcgcgcccgcatccgcagcttcgcctcgatcggctcggagccgacgatcatgctgacc
ggccccagtttctccgccgagaaggcgctgaagcgggccggcatgacgaaggacgacatc
gacctgtgggagctgaacgaggcgttcgcctcggtcgtgctgcgcttcatgcaggcgctc
gacatcgaccatgacagcatcaacgtcaacggcggcgccatcgccatgggccacccgctg
ggcgccaccggcgccatgatcctgggcatcctgctggacgagatggaacgccgggacctg
gagacgggcctcgccaccctctgcgtcggggccggcatgggtacggccaccatcgtcgag
cgcgtctga

DBGET integrated database retrieval system