KEGG   Rhodospirillum centenum: RC1_2111Help
Entry
RC1_2111          CDS       T00785                                 

Gene name
bchM
Definition
(GenBank) magnesium protoporphyrin O-methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
rce  Rhodospirillum centenum
Pathway
rce00860  Porphyrin and chlorophyll metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RC1_2111 (bchM)
Enzymes [BR:rce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     RC1_2111 (bchM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS Cons_hypoth95 CMAS PrmA PCMT Methyltransf_9 NodS DUF2690 Methyltransf_32 UPF0020 Methyltransf_18 RrnaAD TPMT Ubie_methyltran MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: ACI99500
UniProt: B6ITW4
Position
complement(2169565..2170266)
Genome map
AA seq 233 aa AA seqDB search
MENATYLERREAIETYFDRTAADAWSRLTSDAPVSRVRATVRAGRDRMRATLLSWLPQDL
AGRRLLDAGCGTGMLSVEAAKRGAHVTAIDISPTLVGLAGERLPHDLGVGHIDFRVGDML
DPALGRFDHVVSMDSLIHYEAADITAALAKLAARTSGSIVFTFAPRTAALTVMHAVGKLF
PRGDRAPAIVPVGEQTLRRLIAAEPGLKGWRCGRTERIVSGFYTSQAMELVPA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgacctatctggagcggcgcgaggccatcgagacctatttcgaccgcacg
gcggccgatgcctggtcgcggctgacctccgatgcgccggtcagtcgcgtgcgcgcgacc
gtgcgcgccgggcgcgaccggatgcgggcgacgctgctgtcctggctgccccaggatctg
gccggccggcgcctgctggacgcgggctgcggcaccggcatgctgtcggtggaggcggcg
aagcgcggcgcgcatgtcacggccatcgacatctcgcccaccctggtcgggctggccggc
gagcggctgccgcacgatctgggcgtcggccacatcgacttccgcgtcggggacatgctg
gacccggcgctgggccggttcgaccatgtcgtctccatggacagcctgatccactacgag
gccgccgacatcacggcggccctggcgaagctggcggcccgcacctccggctcgatcgtc
ttcaccttcgccccgcgcacggcggcgctcacggtgatgcatgcggtgggcaagctgttc
ccccgcggcgaccgggcgccggccatcgtgccggtcggtgagcagaccctgcgacgcctg
atcgcggccgagccggggctgaagggctggcgctgcgggcggacggaacggatcgtcagc
ggcttctacacctcgcaggccatggagctcgtccccgcatga

DBGET integrated database retrieval system