KEGG   Rhodospirillum centenum: RC1_2336Help
Entry
RC1_2336          CDS       T00785                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
rce00010  Glycolysis / Gluconeogenesis
rce00620  Pyruvate metabolism
rce00640  Propanoate metabolism
rce00680  Methane metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_2336 (acsA)
   00620 Pyruvate metabolism
    RC1_2336 (acsA)
   00640 Propanoate metabolism
    RC1_2336 (acsA)
  Energy metabolism
   00680 Methane metabolism
    RC1_2336 (acsA)
Enzymes [BR:rce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RC1_2336 (acsA)
Lipid biosynthesis proteins [BR:rce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RC1_2336 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACI99722
UniProt: B6IPM0
Position
2410253..2412193
Genome map
AA seq 646 aa AA seqDB search
MTDTSIFPVPEAFASDAWVDAASYQRLYDQSISDPEAFWAEQGKRIDWIRPYTQVKDCSF
SGDVHIRWFHDGTLNVSANCIDRHLATRADQTAILWEGDSPAEHRHISYAELHANVCRLA
NVLKKHGVQKGDRVTIYMPMIPETAFAMLACARIGAIHSVVFGGFSPDSLKDRIQDCDSR
IVLTADEGLRGGRKVPLKANVDQALKSCPDVGTVIVVRRTGGQVAWEDGRDFWYHEEVSA
VSPDCPPEEIGAEDPLFILYTSGSTGKPKGVLHTSGGYLVYASMTHQYVFDYHDGDIYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGIPNYPDSSRFWQVVDKHKVNIFYTAPTAIRA
LMREGEGPVKRTSRNSLRLLGSVGEPINPEAWLWYHTVVGEGRCPIVDTWWQTETGGILI
SPLPGAIPTKPGSATLPFFGVRPVVVDNEGHHLEGATEGNLCIADSWPGQMRTVFGDHER
FVQTYFSTFPGKYFTGDGCRRDDDGYYWITGRVDDVINVSGHRMGTAEIESALVAHPKVA
EAAVVGYPHDLKGQGIYAYVTLVDGEEPTEPLRKELVQWVRKEIGPIASPDLIQFAPGLP
KTRSGKIMRRILRKIAANEHEALGDTSTLADPTVVTELVENRQNRV
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacctcgatctttcccgtgcccgaggcgttcgcttccgacgcctgggtggac
gccgccagctatcaacgcctgtacgaccagtcgatctccgatccggaggcgttctgggcc
gaacagggcaagcgcatcgattggatcaggccctatacccaggtgaaggactgctccttc
agcggcgatgtccacatccgctggttccatgacggcacgctgaacgtctcggccaactgc
atcgaccggcatctcgccacccgggccgaccagaccgccatcctctgggagggcgacagc
cccgccgagcaccggcacatcagctacgccgagctgcacgccaatgtctgccgcctcgcc
aacgtgctgaagaagcacggcgtccagaagggcgaccgggtcaccatctacatgccgatg
atcccggagacggccttcgccatgctggcctgcgcccgcatcggcgccatccattcggtg
gtgttcggcggcttctccccggacagcctgaaggaccgcatccaggactgcgacagccgc
atcgtgctgaccgcggacgagggcctgcgcggcggccgcaaggtgccgctgaaggccaat
gtggaccaggccctgaagtcctgccccgatgtcggcaccgtgatcgtcgtccgccgcacc
ggcgggcaggtcgcctgggaggacgggcgcgacttctggtatcatgaggaggtgtcggcg
gtgtcgcccgactgcccgccggaggagatcggggccgaggacccgctgttcatcctctat
acctcgggcagcaccggcaaacccaagggcgtgctgcacaccagcggcggctatctggtc
tacgcctcgatgacgcaccagtacgtcttcgactaccacgatggcgacatctactggtgt
acggcggacgtgggctgggtcaccggccacagctacatcgtctacggcccgctggcgaac
ggcgccaccaccctgatgttcgagggcatcccgaactacccggactccagccgcttctgg
caggtggtggacaagcacaaggtcaacatcttctacaccgcccccaccgccatccgcgcc
ctgatgcgcgagggcgaggggccggtgaagcgcaccagccggaacagcctgcgcctgctg
ggctcggtgggcgagccgatcaacccggaagcctggctctggtatcacaccgtggtcggc
gagggccgctgcccgatcgtggacacctggtggcagacggagacgggcggcatcctgatc
tcgccgctgccgggcgccatcccgaccaagccgggctccgccaccctgcccttcttcggc
gtcaggccggtggtcgtggacaatgagggccaccacctggagggcgcgacggagggcaat
ctctgcatcgcggacagctggccgggccagatgcgcaccgtgttcggcgaccatgaacgc
tttgtgcagacctatttcagcaccttcccgggcaagtacttcaccggcgacggctgccgc
cgcgacgacgacggttactactggatcaccggccgcgtggacgacgtgatcaacgtctcc
ggccaccgcatgggcacggcggagatcgagagcgccctggtcgcccaccccaaggtggcg
gaggccgcggtcgtcggctacccgcacgacctcaagggccagggcatctacgcctatgtc
accctggtggacggggaggagccgaccgaacccctgcgcaaggagctggtgcagtgggtg
cgcaaggagatcggcccgatcgccagcccggacctgatccagttcgcgccgggcctgccc
aagacccggtcgggcaagatcatgcgccgcatcctgcgcaagatcgccgccaacgagcat
gaggccctgggcgacacctccaccctggccgatccgaccgtggtgacggaactggtggag
aaccggcagaaccgcgtctga

DBGET integrated database retrieval system