KEGG   Rhodospirillum centenum: RC1_2961Help
Entry
RC1_2961          CDS       T00785                                 

Gene name
rdgB
Definition
(GenBank) HAM1 family protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
rce  Rhodospirillum centenum
Pathway
rce00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RC1_2961 (rdgB)
Enzymes [BR:rce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     RC1_2961 (rdgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ACJ00329
UniProt: B6IVK5
Position
3038505..3039116
Genome map
AA seq 203 aa AA seqDB search
MTAPRRFAGDTLVIASHNRGKVREIADLLAAHVRHFPSAAELDLPEPEETEATFIGNAAL
KARAAALASGLPALADDSGLWVDALDGAPGIYSARWAGPEKDFGAAMERVRRELEAAADR
RGDRARFVCALALAWPDGHVEAVEGTAHGTLTFPPRGGKGFGYDPVFIPDGHACTYAELD
PAHKHAISHRADAFRQLLARCFA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgcgccgcttcgccggggacacgctggtcatcgccagccacaaccggggc
aaggtgcgggagatcgccgacctgctcgccgcccatgtccggcacttcccctccgccgcc
gagctggacctgcccgagccggaggagacggaggcgaccttcatcggcaacgcggcgctg
aaggcgcgggcggcggcgctcgcctccggtctgccggcgctggccgacgacagcgggctc
tgggtcgatgcactggacggcgcgccaggcatctattccgcccgctgggccgggccggag
aaggacttcggcgccgccatggagcgggtgcggcgggagctggaggcggcggccgaccgc
cgcggcgaccgcgcccgcttcgtctgcgccctggcgctggcctggccggacggccatgtc
gaggcggtggagggcaccgcccacggcacgctgaccttcccgccgcgcggcggcaagggc
ttcggctacgatccggtcttcatcccggacggccacgcctgcacctatgcggagctggac
ccggcgcacaagcacgccatcagccaccgcgccgacgccttccgccagctcctggcccgc
tgcttcgcctga

DBGET integrated database retrieval system