KEGG   Rhodospirillum centenum: RC1_3642Help
Entry
RC1_3642          CDS       T00785                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rce  Rhodospirillum centenum
Pathway
rce00260  Glycine, serine and threonine metabolism
rce00750  Vitamin B6 metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01230  Biosynthesis of amino acids
Module
rce_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RC1_3642 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RC1_3642 (thrC)
Enzymes [BR:rce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RC1_3642 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACJ00991
UniProt: B6IXG7
Position
3768377..3769792
Genome map
AA seq 471 aa AA seqDB search
MKYISTRGQAPALPFDEVLLAGLARDGGLYVPDAWPALGPDALRALRGRPYDEVAAAVML
PFLGGRIAEADFRRLLADTYGPSVFAHRAVTPLVQLDQRTWLMELFHGPTLAFKDVALQL
LGRLFDHVLAVRGERMTVVGATSGDTGSAAIEACRDRERVDIVILHPHGRTSAVQRRQMT
TVLSPNVHNVALQGTFDDCQDAVKAMFNDAAFRDGLHLSAVNSINWARIMAQIVYYVAAA
VALGAPDRPVAFAVPTGNFGNVYAAYAARAMGVPVAKLIVGSNANDILARFFASGRMETR
AVVPTISPSMDIQISSNFERLLFDLMDRDGAAVATSMAEFRRSGRFAVSQGQLARALELF
EGHRCGEEATLETMARVHRDSGLLIDPHTAVGVAAAQAADLDPSVPVVSLACAHPAKFPD
AVEKATGVRPGLPRHLADLFEREERVTVLPNDLGTLQDFVRARSRVTAGAA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacatcagcacgcggggacaggcccccgccctcccgttcgacgaggttctgctg
gcagggctggcgcgggacggcggcctttatgtccccgacgcctggccggcgctgggtccc
gatgcgctgcgcgccctgcgcggccggccctatgacgaggtggcggcggcggtgatgctg
cccttcctgggcggccgcatcgccgaggcggacttccgccgcctgctggccgacacctac
gggccgtcggtcttcgcccaccgggcggtgacgccgctggtccagctcgaccagcgcacc
tggctgatggaactgttccacggccccacgctggccttcaaggacgtggcgctgcaactg
ctcggccgcctgttcgaccatgtgctggccgtgcgcggggagcgcatgaccgtggtgggc
gccacctccggcgacaccggctccgccgccatcgaagcctgccgcgaccgcgagcgggtg
gacatcgtgatcctgcacccgcacggccgcacctcggccgtgcagcgccggcagatgacg
acggtgctctcgcccaacgtccacaacgtcgccctgcaagggaccttcgacgactgccag
gacgccgtgaaggcgatgttcaacgatgcggccttccgcgacgggctgcacctctcggcg
gtcaactccatcaactgggcccggatcatggcccagatcgtctattacgtggcggcggcg
gtggcgctgggggcgcccgaccggccggtcgccttcgccgtgcccacgggcaatttcggc
aatgtctatgccgcctatgccgcccgcgccatgggcgtgccggtggcgaagctgatcgtg
ggcagcaacgccaacgacatcctggcccgcttcttcgccagcggccggatggagacgcgg
gccgtggtgcccaccatcagccccagcatggacatccagatctccagcaacttcgagcgc
ctgctgttcgacctgatggaccgtgacggcgccgccgtggccaccagcatggcggagttc
cgccgcagcggccgcttcgccgtctcgcagggccagctcgcccgcgcgctggagctgttc
gaggggcaccgctgcggcgaggaggcgacgctggagacgatggcgcgggtccaccgcgac
agcggcctgctgatcgacccgcacacggccgtgggcgtggcggccgcgcaggccgccgac
ctcgatccctcggtgccggtcgtgtcgctggcctgcgcccacccggccaagttccccgac
gcggtggagaaggccacgggcgtgcgccccggcctgccgcggcatctggcggacctgttc
gagcgggaggagcgggtcaccgtcctgccgaacgatctcggcacgctccaggacttcgtg
cgggcgcgctcccgcgtcacggcgggggcggcgtga

DBGET integrated database retrieval system