KEGG   Rhodospirillum centenum: RC1_4060Help
Entry
RC1_4060          CDS       T00785                                 

Gene name
cbbR1
Definition
(GenBank) RuBisCO operon transcriptional regulator
  KO
K21703  LysR family transcriptional regulator, low CO2-responsive transcriptional regulator
Organism
rce  Rhodospirillum centenum
Brite
KEGG Orthology (KO) [BR:rce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rce03000]
    RC1_4060 (cbbR1)
Transcription factors [BR:rce03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    RC1_4060 (cbbR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like
Motif
Other DBs
NCBI-ProteinID: ACJ01399
UniProt: B6IYM5
Position
complement(4281453..4282397)
Genome map
AA seq 314 aa AA seqDB search
MSIRNATIRQLQIFAAAARTLSFARVAEQFRLTPGAISFQIKQIEGLCGFPLFERVGRSV
VLTDAGAALLDHATVILKELNDADQQMEALRGSTGGSVTLGLVSTAKYIVPHLLSRFQAE
RPGVTITLQDGNRRKIHAAVIKGDVDIAIMGRPSAEVVESVAFANHPSTIIAAPSHPLTR
GGRLRLHDLENERFIVREEGSGTRALMDGFFRSQGLTPRIAMTTSSNEMIKQAVMAGIGI
ALISRHTIQLELAIGLLRELDIEGLPLMRAWYVVHRRSLPLLPVHSQFRQFMQERGQAII
DDLARRHTGRLPTG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgcaacgccacgatccggcagctccagatcttcgcggcggccgcgcgcacc
ctgtcgttcgcccgggtggccgagcagttccgcctgacgccgggcgcgatctccttccag
atcaagcagatagaggggctgtgcggattcccgctgttcgagcgggtcggccgcagcgtg
gtgctgaccgatgccggggccgcattgctggaccatgccaccgtgatcctgaaggaactg
aacgacgccgaccagcagatggaagcgctgcgcggcagcaccggcggcagtgtgacgctg
gggctggtcagcacggccaagtacattgtgccgcacctgctgtcccgcttccaggcggag
cggccgggggtgaccatcaccctgcaggatggcaaccgccgcaagatccatgcggccgtc
atcaagggcgatgtggacatcgccatcatgggccggccctcggccgaggtggtcgagtcg
gtggccttcgccaaccacccctcgaccatcatcgccgcccccagccatccgctgacccgg
ggcgggcggctgcggctgcacgacctggagaacgagcggttcatcgtgcgcgaggaggga
tcgggcacccgggcgctgatggacggtttcttccgcagccagggtctgaccccgcggatc
gccatgaccaccagcagcaacgagatgatcaagcaggcggtgatggccggcatcggcatc
gccctgatctcgcgccacaccatccagcttgagctggccatcggcctgctgcgcgagctg
gacatcgaggggctgccgctgatgcgcgcatggtacgtggtccaccgccgcagcctgccg
ctgctgccggtccacagccagttccgccagttcatgcaggaacgcggccaggccatcatc
gacgacctggcccgccggcacaccggccgtctgccgacggggtga

DBGET integrated database retrieval system