KEGG   Rhodospirillum centenum: RC1_4065Help
Entry
RC1_4065          CDS       T00785                                 

Gene name
cbbF
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rce  Rhodospirillum centenum
Pathway
rce00010  Glycolysis / Gluconeogenesis
rce00030  Pentose phosphate pathway
rce00051  Fructose and mannose metabolism
rce00680  Methane metabolism
rce00710  Carbon fixation in photosynthetic organisms
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
Module
rce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
rce_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rce_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
rce_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_4065 (cbbF)
   00030 Pentose phosphate pathway
    RC1_4065 (cbbF)
   00051 Fructose and mannose metabolism
    RC1_4065 (cbbF)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_4065 (cbbF)
   00680 Methane metabolism
    RC1_4065 (cbbF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rce04147]
    RC1_4065 (cbbF)
Enzymes [BR:rce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     RC1_4065 (cbbF)
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC1_4065 (cbbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: ACJ01404
UniProt: B6IYN0
Position
4286181..4287296
Genome map
AA seq 371 aa AA seqDB search
MPHRRTTFSRFIIEDQRRRGGSDTELTALLNDVQTACKFIATAVARGSLKQPYTPIGVET
VAAPGVNVHGEMQKPLDLIANEIFLRNCEFGGQVCGMASEEMEEPYVIPAQFPRGRYLLV
FDPLDGSSNLDVNVTVGTIFSILRAPEGVTEPTVEDFLQPGTQQVAAGFALYGPVDMIIT
TFGEGVHGFTLDREVGAYTLTHPNMRIPEKACEFAINASNERFWEPPVRRYVEECIEGKT
GPRGQDFNMRWVASLVAEVYRILIRGGLFMYPRDTRPSCKPGRLRLLYEANPIAMVVEQA
GGAASTGRQRILDIKPESLHQRVPLILGSKAEVERLDRYHAAYDRGEDLKFEAPLFGTRS
VFITPVSATQD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatcgtcgaacgacgttcagtcgcttcataatcgaagatcagcgccgccgcggt
ggcagcgataccgaactgaccgcgctgctgaacgacgtgcagaccgcctgcaagttcatt
gcgacggccgtcgcccggggctccctcaagcagccttacacccccatcggggtggaaacc
gtcgcggcgcccggcgtgaacgtccatggcgagatgcagaagccgctggacctcatcgcc
aacgagatcttcctgcggaactgcgagttcggcggccaggtctgcggcatggcctcggag
gagatggaggagccctacgtcattcccgcgcagttcccgcgcggccgctacctcctggtc
ttcgatccgctggacggttcctccaacctggacgtcaacgtcacggtcggcaccatcttc
tcgatcctgcgcgcgcccgagggcgtgaccgaaccgaccgtcgaggatttcctgcagccg
ggcacgcagcaggtggcggccggcttcgccctctacggcccggtggacatgatcatcacc
accttcggcgagggcgtgcacggcttcacgctggaccgcgaggtcggcgcctataccctg
acgcatccgaacatgcgcatccccgagaaggcgtgcgagttcgccatcaacgcctcgaac
gagcgtttctgggaaccgcccgtccgccgctacgtggaggagtgcatcgagggcaagacc
ggcccgcgcgggcaggacttcaacatgcgctgggtcgccagtctggtggcggaggtctac
cgcatcctgatccgcggcggcctgttcatgtacccgcgggatacccgcccgtcctgcaag
cccggccgtctccgcttgctctacgaggccaaccccatcgccatggtggtggaacaggcc
ggcggggccgccagcaccggacgtcagcgcatcctggacatcaagccggagagcctgcac
cagcgcgtgcccctgatcctcggctccaaggccgaggtggagcggctcgaccgctaccat
gcagcctacgaccggggggaggacctgaagttcgaggcgccgctgttcggcacccgctcg
gtcttcatcacccccgtttccgccacccaggattga

DBGET integrated database retrieval system