KEGG   Rhodospirillum centenum: RC1_4067Help
Entry
RC1_4067          CDS       T00785                                 

Gene name
cbbT
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
rce00030  Pentose phosphate pathway
rce00710  Carbon fixation in photosynthetic organisms
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
rce01230  Biosynthesis of amino acids
Module
rce_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
rce_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rce_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
rce_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RC1_4067 (cbbT)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_4067 (cbbT)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    RC1_4067 (cbbT)
Enzymes [BR:rce01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     RC1_4067 (cbbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACJ01406
UniProt: B6IYN2
Position
4288250..4290313
Genome map
AA seq 687 aa AA seqDB search
MTATAEAGAQEALAPTMPDPLSPAERRHLANALRVLAIDAVEAAKSGHPGMPMGMADIAE
ALWRRHLRHNPADPAWPDRDRFVLSNGHGSMLLYGLLHLTGYDLPIEELKRFRQLHSKTP
GHPEYGLTPGVETTTGPLGQGIANAVGMALAERLLAAEFNRPDHTIVDHRTFCFVGDGCL
MEGLSHEVCSLAGTLGLEKLVVLYDDNGISIDGHVVGWFADDTPKRFEAYGWRVIRDVDG
HDAAALDRALAEAVTPCGKPTLICCKTVIGWGSPAKAGTHDVHGAPLGAAESAAAKAEMG
WTAAPFEIPEDVRAGWDARGRGAALEGAWQERFRRYAEAHPDLAAEFTRRVSGELPADFA
RAADAWIAETAARTDTVATRKASQQAIQALAGLLPEMLGGSADLTGSNLTDWKGSASVRM
TGGGSYVHYGVREFGMTAMMNGVALHGGYLPFGGTFLVFSDYARNGLRLAALMGLRVVHV
LTHDSIGLGEDGPTHQPIEHAASLRLMPNMDVWRPCDALETAVAWRTAVERHTGPSCLLL
SRQGLPAQSGPGRTDGAARGGYVLAEADGGRPDVVLIATGSEVQVVMEARTVLAGRGIAA
RVVSMPCCELFDRQDEAWKASVLPAGVPRMAVEAGAPDLWRKYVGLDGDVVGIARFGESA
PAGDLYRFFGLTADAVAQRTARLLGRV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccgcagaggccggcgcacaggaagcccttgccccgacgatgcccgacccc
ctgtccccggcggagcgtcggcaccttgccaacgcgctgcgggtgctggcgatcgacgcg
gtggaggcggccaagtccggccaccccggcatgcccatgggcatggccgacatcgccgag
gcgctgtggcgccgtcacctgcgccacaacccggccgatccggcctggccggaccgtgac
cgcttcgtgctgtcgaacggccacggctcgatgctgctctacggtctgctgcacctcacc
ggctacgacctgccgatcgaggagctgaagcggttccgccagctccactccaagacgccg
ggccaccccgaatacggcctcacgccgggcgtggagacgacgaccggcccgctcggccag
ggcatcgccaacgccgtcggcatggcgctggccgagcgcctgctggcggccgagttcaac
cggccggaccacaccatcgtcgatcaccgcaccttctgcttcgtcggcgacggctgcctg
atggagggtctcagccacgaggtctgctcgctcgcgggcacgctggggctggagaagctg
gtcgtgctctatgacgacaacggcatctccatcgacggccatgtcgtcggctggttcgcc
gacgacacgccgaagcggttcgaggcctatggctggcgcgtcatccgcgacgtggacggg
cacgacgcggcggcgctggaccgggcgctggccgaggcggtgacaccctgcggcaagccc
accctgatctgctgcaagaccgtcatcggctggggcagcccggccaaggccggcacccac
gatgtccacggcgcgcccctgggggccgccgagtccgccgccgccaaggcggagatgggc
tggaccgcggccccgttcgagatccccgaggacgtgcgcgccggctgggacgcgcgcggc
cgcggcgccgccctggagggcgcgtggcaggagcggttccgccgttatgccgaggcgcac
cccgatctggcggccgagttcacccgccgcgtctcgggcgagctgccggcggacttcgcc
agggcggccgacgcctggatcgcggagacggcggcccgcaccgacaccgtcgccacccgc
aaggcctcgcagcaggcgatccaggccctggccggcctgctgccggagatgctgggcggc
tcggccgacctgaccggctccaacctcaccgactggaagggttccgcctcggtccgcatg
accggcggcggcagctacgtgcattacggcgtgcgcgagttcggcatgaccgcgatgatg
aacggcgtggcgctgcatggtggctacctgccgttcggcggcactttcctggtcttctcc
gactatgcccgcaacggcctgcggctggccgccctgatggggctgcgcgtcgtccatgtg
ctgacgcacgacagcatcggcctgggcgaggacgggccgacccaccagccgatcgagcac
gccgccagcctgcggctgatgcccaacatggatgtctggcggccctgcgatgcgctggag
acggcggtcgcgtggcgtaccgccgtggagcgccacaccggcccgagctgcctgctgctg
tcccggcaggggctgccggcgcagagcggccccggccggaccgacggcgccgcccgcggc
ggctatgtgctggcggaggccgatggcggcaggccggacgtggtgctgatcgccaccggc
tccgaggtgcaggtggtgatggaggccaggacggtgctggccgggcgcggcatcgcggcg
cgggtcgtctccatgccctgctgcgagctgttcgaccgccaggacgaggcgtggaaggcg
tccgtgctgcccgccggcgtgccgcgcatggccgtggaggccggggcccccgacctctgg
cgcaagtatgtcggcctggacggcgacgtggtgggcatcgcgcgcttcggcgaatccgcc
ccggccggcgacctctaccgcttcttcggcctcacggccgatgccgtggcgcagcgcacg
gcgcggctgctgggccgcgtctga

DBGET integrated database retrieval system