KEGG   Rhodospirillum centenum: RC1_4069Help
Entry
RC1_4069          CDS       T00785                                 

Gene name
cbbZ
Definition
(GenBank) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
rce  Rhodospirillum centenum
Pathway
rce00630  Glyoxylate and dicarboxylate metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_4069 (cbbZ)
Enzymes [BR:rce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     RC1_4069 (cbbZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ACJ01408
UniProt: B6IYN4
Position
4291458..4292162
Genome map
AA seq 234 aa AA seqDB search
MTSRPEPTVQAFPALVFDLDGTLLDSVPDIGQALNRTLMDLGRPTVSPAQVRRFVGDGVR
RLVERGLEATGGLPDAGAQDAALDRFMAIYGAIPADPACIFPGVLDTLRALAAAGHGLAV
CTNKPEAITRDLLRDLGLLDLLAAVVGGDTLPQRKPAPEPLLAAIARMGASPAGALMVGD
SENDVATARAAGVPVVAVTYGYSRVPVPELGADHVIDRFDALPGAIASLASRRA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgtccggagccgaccgtccaggccttcccggccctggtcttcgatctggac
gggaccctgctggacagcgttcccgacatcgggcaggcgctgaaccgcacgctgatggat
ctgggccggccgaccgtgtcgccggcccaggtgcggcgcttcgtcggcgatggcgtgcgc
cggctggtggagcgcgggctggaggcgaccggcggcctgcccgacgcgggggcgcaggac
gccgccctcgaccgcttcatggccatctatggcgccatccccgccgatccggcctgcatc
ttccccggggtgctggacaccctgcgggcgctggccgcggcggggcacggccttgccgtc
tgcaccaacaagcccgaggcgatcacccgcgacctgctgcgcgacctcggcctgctggat
ctgctggccgccgtcgtcggcggcgacacgctgccccagcgcaagccggcgccggagccg
ctgctggcggctatcgcacgcatgggggcatcgccggccggggccctgatggtgggcgac
agcgagaacgatgtcgccacggcgcgcgccgccggggtgcccgtcgtcgccgtcacctac
ggctattcccgcgtgccggtccccgagctgggggccgaccatgtgatcgaccgattcgat
gcgttgcccggcgcgatcgcctccctggcgtcgcggcgggcctga

DBGET integrated database retrieval system