KEGG   Rhodospirillum centenum: RC1_4071Help
Entry
RC1_4071          CDS       T00785                                 

Gene name
purT
Definition
(GenBank) phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
rce  Rhodospirillum centenum
Pathway
rce00230  Purine metabolism
rce00670  One carbon pool by folate
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01130  Biosynthesis of antibiotics
Module
rce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RC1_4071 (purT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RC1_4071 (purT)
Enzymes [BR:rce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     RC1_4071 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C CPSase_L_D2 ATPgrasp_Ter ATP-grasp_3 Pyr_redox 2-Hacid_dh_C ATP-grasp_4 XdhC_C Pyr_redox_2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACJ01410
UniProt: B6IYN6
Position
complement(4292980..4294152)
Genome map
AA seq 390 aa AA seqDB search
MAFTARILLLGSGELGREFAISAKRLGCHVVACDSYAGAPAMQVADAAEVFPMLDADRLR
DAIERHRPDFIVPEVEAIRTEVLQEVEARGFTVVPSARATYMTMNRDRIREVAAVELGLR
TSRYRYAESLEDVEAAAAHTGFPCVIKPVMSSSGKGQSTVDAPDKLAAAWEYAVANMRGD
RRKVIVEEFIRFEYEITLLTVRTRQGVLFCEPIGHRQERGDYQESWQPVGMAPALLAAAQ
EMARKVVDDLGGYGIFGVEFFVTKDEVIFSELSPRPHDTGMVTLLSQTLSEFDLHARAIL
GLPIPAIDLRGPTASAVILADRDSDRFAFEGLAEALAVGRADQAVDVRLFGKPTTRPYRR
MGVALATGTTAEEARRTATEAAARVHIRYE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaccgcccggattctgctgctcggctccggcgagctgggtcgggagttcgcc
atctcggccaagcggctgggctgccatgtcgtggcctgcgacagctatgccggcgctccc
gccatgcaggtggccgacgcggcggaggtcttccccatgctggatgccgaccggctgcgc
gacgccatcgagcgccaccggccggacttcatcgtgccggaggtggaggcgatccgtact
gaggtgctgcaggaggtggaggcccggggcttcaccgtcgtgccctccgcccgcgccacc
tacatgaccatgaaccgcgaccgcatccgcgaggtcgcagcggtggagctggggctgcgc
acctcccgctaccgctatgccgagagcctggaggacgtcgaggcggccgcggcccacacc
gggtttccctgcgtcatcaagccggtgatgtcctcctccggcaagggccagagcacggtg
gacgcaccggacaagctggccgccgcctgggagtacgccgtcgccaacatgcgtggcgac
cgccgcaaggtgatcgtcgaggagttcatccgcttcgagtacgagatcaccctgctgacc
gtgcggacgcggcagggcgtgctgttctgcgagccgatcggccaccggcaggagcgcggc
gactaccaggaatcctggcagcccgtgggcatggcccccgccctgctggccgccgcgcag
gagatggcgcgcaaggtggtggacgatctgggcggctacggtatcttcggcgtggagttc
ttcgtcacgaaggacgaggtgatcttctccgaactgagcccgcggccgcacgacaccggc
atggtgacgctgctgtcgcagaccctgtcggaattcgacctgcacgcccgcgccatcctg
ggcctgccgatcccggccatcgacctgcgcgggccgaccgcctcggccgtcatcctggcc
gaccgcgattccgaccgtttcgccttcgagggtctggccgaggcgctggccgtgggccgc
gcggaccaggcagtggatgtgcgcctgttcggcaagccgacgacgcgcccctaccgccgc
atgggcgtggcgctcgccaccggcaccaccgccgaggaggcacgccgcaccgcgaccgag
gccgcggcacgggtgcatatccgctacgaatag

DBGET integrated database retrieval system