KEGG   Rhodospirillum centenum: RC1_4085Help
Entry
RC1_4085          CDS       T00785                                 

Gene name
hisC
Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
rce  Rhodospirillum centenum
Pathway
rce00340  Histidine metabolism
rce00350  Tyrosine metabolism
rce00360  Phenylalanine metabolism
rce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rce00401  Novobiocin biosynthesis
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01130  Biosynthesis of antibiotics
rce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    RC1_4085 (hisC)
   00350 Tyrosine metabolism
    RC1_4085 (hisC)
   00360 Phenylalanine metabolism
    RC1_4085 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RC1_4085 (hisC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    RC1_4085 (hisC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rce01007]
    RC1_4085 (hisC)
Enzymes [BR:rce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     RC1_4085 (hisC)
Amino acid related enzymes [BR:rce01007]
 Aminotransferase (transaminase)
  Class II
   RC1_4085 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Alliinase_C DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACJ01424
UniProt: B6IYQ0
Position
4307021..4308109
Genome map
AA seq 362 aa AA seqDB search
MSGPIPNPGILDIAPYVGGEHSAPGVTRLLRLASNEGALGPSPRAVEAFRAVGPEIHRYP
DGGSTRLREAIGHRFGLDPARVLCFNGSDEVLHLLAQAYAGPGGEVLYSRHGFLVYPIAA
RAAGATPVAAPERNLTTDVDALLARVSERTRIVYVANPNNPTGSYLPADALARLHAGLPP
HVLLVIDAAYAEYVTANDYADGTALVARFDNVVMTRTFSKLFGLGGMRLGWAYCPPAVAD
ALHRVRSPFNVSVAAQAAGVAALEDLEFQERSRALNEQSRTAFTGRVRALGLVVHPSVCN
FVLVDFAATGRPAEEARQFLKARGILVRQMGAYGLPDCLRITMGLPAEMEEVADALGDWL
KG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtccgatccccaaccccggaatcctcgacatcgccccctatgtcggcggggag
cattccgcccccggcgtgacgcggctgctgcgccttgcctccaacgagggggcgctgggg
cccagcccccgcgcggtggaggcgttccgtgccgtcgggccggagatccaccgctatccc
gacggcggctcgacccggctgcgggaggccatcggccaccgtttcggcctcgatccggcg
cgggtgctctgcttcaacggctcggacgaggtgctgcacctgctggcccaggcctatgcc
ggcccgggcggggaggtgctctacagccggcacggcttcctggtctacccgatcgccgcc
cgcgccgccggggcgacgccggtggccgcaccggagcggaacctgaccaccgacgtggac
gccctgctggcccgggtcagcgagcggacccgcatcgtctatgtcgccaacccgaacaac
ccgaccggcagctatctgccggccgacgcgctggcgcgcctgcacgccggcctgccgccg
catgtcctgctggtgatcgacgcggcctatgccgagtacgtcaccgccaacgactatgcc
gacggcaccgccctggtggcccgtttcgacaatgtcgtgatgacccgcaccttctcgaag
ctgttcgggctgggcggcatgcgcctgggctgggcctactgcccgcccgccgtggcggat
gcgctgcaccgtgtccgcagccccttcaatgtcagcgtcgccgcccaggcggccggcgtc
gcggcgctggaggatctggagttccaggagcgcagccgggcgctgaacgagcagagccgg
accgccttcaccggccgggtgcgggcgctggggctggtggtgcatccctccgtctgcaac
ttcgtgctggtggacttcgccgccaccggccgcccggcggaggaggcgcggcagttcctc
aaggcgcgcggcatcctggtgcgccagatgggcgcctatggcctgccggactgcctgcgc
atcaccatgggcctgcccgcggagatggaagaggtggcggacgccctgggcgactggctg
aagggatga

DBGET integrated database retrieval system