KEGG   Rhodospirillum centenum: RC1_4086Help
Entry
RC1_4086          CDS       T00785                                 

Gene name
tyrA
Definition
(GenBank) prephenate dehydrogenase
  KO
K00220  cyclohexadieny/prephenate dehydrogenase [EC:1.3.1.43 1.3.1.12]
Organism
rce  Rhodospirillum centenum
Pathway
rce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rce00401  Novobiocin biosynthesis
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RC1_4086 (tyrA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    RC1_4086 (tyrA)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     RC1_4086 (tyrA)
    1.3.1.43  arogenate dehydrogenase
     RC1_4086 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH NAD_binding_2 F420_oxidored Semialdhyde_dh NAD_Gly3P_dh_N Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: ACJ01425
UniProt: B6IYQ1
Position
4308114..4309004
Genome map
AA seq 296 aa AA seqDB search
MTAPPLFPRVAVIGLGLIGSSLARVLRADPTLAGELVAADRSAAVCARVLELGLADRAET
DPACAVAGADLVILAVPIGACADLAAAIGPHLKPGAILTDVGSVKQAVIRDVAPQVPDGV
HFVPGHPIAGTEHSGPDAGFADLFRGRWCILTPPPGTDPAAVEKVVELWRRAGSMIEVME
PGHHDRVLAITSHLPHLIAYTIVGTATDLEEHLKSEVIRFSASGFRDFTRIAASDPVMWR
DIFLNNREAVLEIIQRFTEDLTALQRAIRWGEAETLEHLFTRTRDIRRGIIDARQA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccgccgctgtttccccgcgtcgccgtcatcgggctcggcctgatcgggtca
tcgctcgcccgcgtgctgcgcgccgacccgaccctggcgggggagctggtggcggccgac
cgcagcgcggcggtctgcgcccgggtgctggagctggggctggccgaccgggcggagacg
gacccggcctgcgcggtggcgggggctgacctcgtgatcctggccgtgccgatcggcgcc
tgtgccgaccttgccgccgccatcggcccgcatctgaagccgggcgccatcctcaccgat
gtcggctcggtcaagcaggcggtgatccgtgatgtcgccccgcaggtgcccgacggggtt
catttcgtccccggccatcccatcgccggcaccgagcattccgggccggacgccggcttc
gcggacctgttccgcgggcgctggtgcatcctgacaccgccgccgggcaccgatcccgcc
gcggtggagaaggtggtggagctgtggcgccgggccggctcgatgatcgaggtgatggag
cccggccaccatgaccgcgttctcgccatcaccagccacctgccgcacctgatcgcctac
accatcgtcggcacggcgaccgacctggaggagcacctgaagtcggaggtgatccgcttc
tccgcctcgggcttccgcgacttcacccgcatcgccgccagcgacccggtgatgtggcgc
gacatcttcctgaacaaccgcgaagcggtgctggagatcatccagcgcttcaccgaggat
ctgaccgcgctgcaacgggccatccgctggggtgaggcggagacgctggagcacctgttc
acccgcacccgcgacatccgccgcggcatcatcgacgcccggcaggcgtga

DBGET integrated database retrieval system