KEGG   Rhodospirillum centenum: RC1_4088Help
Entry
RC1_4088          CDS       T00785                                 

Definition
(GenBank) dipeptidyl anminopeptidase, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S9 Peptidase_S15 DLH Hydrolase_4 Esterase PD40 Abhydrolase_1 BAAT_C DPPIV_N LIP
Motif
Other DBs
NCBI-ProteinID: ACJ01427
UniProt: B6IYQ3
Position
complement(4309640..4311688)
Genome map
AA seq 682 aa AA seqDB search
MTSFRTGLRAAAVALLPLAALVPTAAALAQQARPAQELIPRKDLFGNPSRTAATVSPDGK
SIAFLAPKDGVMNVWVAPLATPDKAKPLTQETLRPIRSYFWAPDSSQILYIQDKGGDENF
LLYGVDLAKGETRTLTPFEKTRVQVIAISETIKDAILVGVNNRDPRWHDVHRLNLKTGEL
TLVRQNDGYAGFAADDTLTLRLATKATADGGYAVETIGPDGTTAPFLTIPHEDGLTSGAL
GFTTDGKTLYLRDSRGRDTSALFAMDMASGRTTLVAENAKADIGGLMANPRTGVVEAYSA
YYETNEWFPVGDALKADIAFLNEKAGGEWSVTSRDDADRIWTVAVDRVTEAPAFYLYDRK
KKALTRLFTTRPELEGRTLATMHPVQIPSRDGLTLVSYLTLPPGSDKDGDGKPETPVPLV
LSVHGGPWARDGYGYNGTHQWLANRGYAVLSVNFRGSTGFGKGFVNAGNLEWGRKMHDDL
IDGVDWAVKQGVTTADKVAIMGGSYGGYATLWGMTATPDRFACGVSIVGPSNLITLLGSI
PPYWASVRENFARRMGDDRTEEGRALLTERSPLSHVQNIRKPLLIGQGANDPRVIQRESD
QIVAAMKEKGIPVTYVLYPDEGHGFARPQNRISFNAVTEAFLSRCLGGAHEPVGTDFDGA
SLTVPEGAQGVPGVAEALAAKK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcgttcagaaccggactccgcgccgccgccgtggcgctgctgccgctcgccgcc
ctggtgccgacggccgcggcgctggcgcagcaggcccggccggcgcaggagctgatcccg
cgcaaggacctgttcggcaaccccagccgcaccgccgcgaccgtcagcccggacgggaag
tccatcgccttcctggcgccgaaggacggggtgatgaatgtctgggtggcgccgctggcg
acgcccgacaaggcgaagccgctgacgcaggagacgctgcgcccgatccgttcctacttc
tgggccccggattcgagccagatcctctacatccaggacaagggcggcgacgagaacttc
ctgctctacggcgtcgatctggcgaagggcgagacgcgcaccctgaccccgttcgagaag
acgcgggtccaggtgatcgccatcagcgagacgatcaaggacgccatcctggttggcgtg
aacaaccgcgatccgcgctggcacgatgtccaccgcctgaacctgaagacgggcgagctg
accctggtccgccagaacgacggctatgccggcttcgccgcggacgacacgctgaccctg
cggctggcgaccaaggccacggccgacggcggctacgcggtggagacgatcgggccggac
gggacgaccgcgccgttcctgaccatcccgcacgaggacgggctgaccagcggcgcgctg
ggcttcaccacggacgggaagacgctctatctgcgcgacagccgcggccgcgacacctcc
gccctgttcgccatggacatggcctcgggccggacgacgctggtggcggagaacgccaag
gccgacatcggcggcctgatggcgaatccgcgcacgggcgtggtcgaagcctacagcgcc
tattacgagacgaacgagtggttcccggtcggcgatgccctcaaggcggacatcgcgttc
ctgaacgagaaggcgggcggcgagtggtccgtcaccagccgcgacgacgcggaccggatc
tggaccgtggcggtggaccgggtgacggaggcgccggccttctatctctacgaccgtaag
aagaaggccctgacgcggctgttcaccacccggccggagctggagggccggacgctggcc
accatgcacccggtgcagatcccgagccgcgacgggctgacgctcgtctcctacctgacg
ctgccgccgggatcggacaaggacggcgacggaaagcccgagacgccggtgccgctggtg
ctgagcgtgcatggcggcccctgggcgcgtgacggctacggctacaacggcacgcaccag
tggctggccaaccgcggctatgccgtgctgtcggtcaatttccgcggctccaccgggttc
ggcaagggcttcgtcaacgccggcaacctggaatggggccggaagatgcacgacgacctg
atcgacggcgtggactgggccgtgaagcagggcgtcaccaccgccgacaaggtcgctatc
atgggcggctcctacggcggttacgccacgctctggggcatgaccgcgacgccggaccgc
ttcgcctgcggcgtcagcatcgtcggtccgtccaacctgatcaccctgctggggagcatc
ccgccctactgggccagcgtgcgggagaacttcgcccgccgcatgggcgacgaccgcacc
gaggagggccgcgcgctgctgaccgagcggtcgccgctgagccatgtgcagaacatccgc
aaacccctgctgatcggccagggcgccaacgatccgcgcgtgatccagcgcgagtccgac
cagatcgtggcggcgatgaaggagaagggcatcccggtgacctacgtcctgtacccggac
gagggccatggtttcgcccggccgcagaaccgcatctccttcaacgccgtgacggaggcg
ttcctgtcccgttgcctgggcggggcgcacgagccggtgggcacggacttcgacggggcc
agcctgacggtgccggaaggcgcccagggggtgcccggcgtggcggaggcgctggcggcg
aagaagtag

DBGET integrated database retrieval system