KEGG   Rhodospirillum centenum: RC1_4092Help
Entry
RC1_4092          CDS       T00785                                 

Gene name
chaC
Definition
(GenBank) cation transport protein ChaC, putative
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
rce  Rhodospirillum centenum
Pathway
rce00480  Glutathione metabolism
rce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RC1_4092 (chaC)
Enzymes [BR:rce01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     RC1_4092 (chaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ChaC GGACT
Motif
Other DBs
NCBI-ProteinID: ACJ01431
UniProt: B6IYQ7
Position
4314373..4314960
Genome map
AA seq 195 aa AA seqDB search
METAPPTVPAPHAEFGHPAGSDLWVFAYGSLMWNPGFPHLERRGALLRGWHRSFCVLSWR
HRGTPERPGAVLGLDRGGSCRGIVYRVAADRVEETLAYLWEREMVNRVYRPRRLAVRTAG
GGSAPALVFTVDRTHPQYCGRLGPEGLETLVRQGVGQSGRSADYLLSLVAHLRDLGIRDA
GLEDLAARVGGPPPD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgccccgccgaccgttcccgccccgcatgccgagttcggccacccggccggc
agcgacctctgggtcttcgcctacggctcgctgatgtggaatcccggcttcccgcacctg
gagcggcgcggggccctgctgcgcggctggcaccgctccttctgcgtgctgtcctggcgc
caccgcggcacgccggagcggccgggcgccgtgctgggcctggaccgcggcggttcctgc
cgcggcatcgtctaccgtgtcgccgcggaccgggtcgaggagacgctggcctatctctgg
gagcgggagatggtgaaccgcgtctaccgcccccgccggctggccgtgcggacggcaggg
ggcggcagcgccccggcgctggtcttcaccgtggaccggacgcacccgcagtactgcggc
cggctcgggccggaggggctggagacgctggtgcgccagggcgtgggccagtccggccgc
agcgccgactacctgctcagcctcgtcgcccacctgcgcgacctcggcatccgcgatgcc
ggcctggaggatctggccgcgcgggtgggcggacccccgccggactga

DBGET integrated database retrieval system