KEGG   Rhodospirillum centenum: RC1_4094Help
Entry
RC1_4094          CDS       T00785                                 

Definition
(GenBank) ribonucleoside-diphosphate reductase, putative
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
rce  Rhodospirillum centenum
Pathway
rce00230  Purine metabolism
rce00240  Pyrimidine metabolism
rce01100  Metabolic pathways
Module
rce_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RC1_4094
   00240 Pyrimidine metabolism
    RC1_4094
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     RC1_4094
DNA repair and recombination proteins [BR:rce03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    RC1_4094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC LAGLIDADG_3 Ribonuc_red_lgN Intein_splicing
Motif
Other DBs
NCBI-ProteinID: ACJ01433
UniProt: B6IYQ9
Position
complement(4317053..4320628)
Genome map
AA seq 1191 aa AA seqDB search
MADSATTDDVTGPAGAGLPPVSRQIWDMKYRLKAPDGAPVDATVADTWTRVARALAAPER
DPAAWEERFRSALEGFRFLPAGRILAGAGTRRTVTLFNCFVMGTVPDDMGGIFAHLREAA
LTLQQGGGIGYDFSTLRPKGAPVAGVGADASGPVSFMDVWDSMCRTIMSAGSRRGAMMAT
LRCDHPDIELFIDAKREPGRLRNFNLSVLATDDFMAAVREDRPWPLRFDGRVFRTVPARA
LWDRIMRATYDYAEPGVIFIDRINEQNNLSYCETISATNPCVTAETWVGTAEGPRQVREL
VGRPFTALLHGRPWPSAPEGFFPTGVRPVLRLRTREGLELRATADHPVRRVVARADGGAA
EEWTALGALKPGDRVRLGEAAVEPGWPPPPGSTAEGEVAGYLLSLLVGDAALKRDKAVLS
VWLPAAEKDAPADMRGVMAAAEAAARFLPHRADFHGRAAVAGRREYRLATAALRNLAARF
GLAPGAKAVTPEIERASSLFQAAFLRGLFDADGRVQGSQAKGVSIWLAQSDLERLRAVQR
MLLRLGIVSTLAADRRARSLRLLPEGRGGRRPCAGAADHELIIARDNVGRFAARIGFADA
DKAGRLRAALSACRRRPDREDWTAEVAELVPDGEAEVFDVRIPGANAFEANGLVVHNCGE
QPLPPYGACLLGSVNLAALVRDPFTPAARLDREELARVVPLAVRMMDNVVDVSRFPLEAQ
EAEAQAKRRIGLGVTGLADALILCGVRYGSEAGVRLTEEWLRAIQVAAYRTSAALAAEKG
AFPLFDREAFLERPMVRALPPDVREAIAAQGVRNALVTSIAPTGTISLFAGNVSSGIEPV
FAYEYQRAVLMPDGSRRTETVQDLAYRLYRERMGPDAPLTDAFVDAQSLEPAAHLVMQAA
AQRHVDSAISKTINCPADLPFEAFKDVYRQAYELGCKGCTTYRPNAVTGSVLSVQATGGA
PAAAPAQAPVQPPVQAPVQAPGPTSAPGRAEPARGEGAVVYMTRPLDRPEALPGHTYKVK
WPDSDHALYITVNDIVQDGRRRPFEVFINSKNMEHYAWTVALTRMISAVFRRGGDVSFVV
EELKAVFDPRGGQWVEGRYVPSLLAAIGQVIERHMLETGFLPRPGAAAGAPRLPAATGGP
AAADPAPDPDPGPATDPSAARLGQCPRCAQATLLRQEGCDLCTNCGYSRCG
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggcggactctgcgacgaccgatgatgtgaccggccccgcgggggccggactgccgccc
gtctcccggcagatctgggacatgaagtaccggctgaaagcgccggacggtgcgccggtg
gacgccaccgtggcggacacctggacccgcgtggcgcgggcgctggcagcaccggagcgc
gacccggcggcctgggaggagcgcttccggtcggcgctggaggggttccgcttcctgccc
gccggccgcatcctggccggggccgggacacggcggacggtgacgctgttcaactgcttc
gtcatgggcaccgtgcccgatgacatgggcggcatcttcgcccacctgcgggaggcggca
ctgacgctgcagcagggcggcggcatcggctacgacttctccaccctgcggcccaagggg
gcgcccgtggccggcgtcggggccgacgcttccggccccgtctccttcatggacgtgtgg
gacagcatgtgccgcaccatcatgagcgccggcagccgccgcggcgccatgatggcgacc
ctgcgctgcgaccaccccgacatcgaactgttcatcgacgccaagcgcgagcccggccgg
ctgcgcaacttcaacctgtcggtcctggcgacggacgatttcatggccgcggtgcgggag
gaccggccctggccgctgcgcttcgacggccgggtcttccgcaccgtgccggcccgcgcc
ctgtgggaccgcatcatgcgggcgacctacgactatgccgagccgggcgtcatcttcatc
gaccgcatcaacgagcagaacaacctgagctactgcgagacgatcagcgccacgaacccg
tgcgtcacggcggagacctgggtggggaccgccgaggggccgcggcaggtgcgggagctg
gtcggccggcccttcaccgccctgctgcatggccggccctggccgtcggcgccggaaggc
ttcttcccgaccggggtcaggccggtgctgcgcctgcgcacccgcgagggcctggaactg
cgcgccacggccgaccatccggtgcggcgggtggtggccagggcggatggcggggccgcg
gaagaatggacggcgctgggggcgctgaagcccggcgaccgcgtccgcctgggcgaagcc
gcggtggagccgggctggccgcccccgcccggttcgaccgccgagggggaggtggccggc
tatctgctgagcctgctggtcggtgacgccgcgctgaagcgggacaaggcggtgttgtcc
gtctggctgcccgcggcggagaaggacgccccggccgatatgcggggcgtgatggccgcg
gcggaggcggcggcgcggttcctgccccaccgcgccgatttccatggccgggccgccgtc
gccggacgccgggagtaccggctggccaccgcggccctgcggaacctggcggcccggttc
gggctggcgcccggcgccaaggccgtgacgccggaaatcgagcgggcgtcgagcctcttc
caggcggccttcctgcgcggcctgttcgatgcggacggccgcgtgcagggcagtcaggcg
aagggcgtcagcatctggctggcgcagagcgacctggaacggctgcgggcggtgcagcgg
atgctgctccgcctcggcatcgtctccaccctggccgcggaccggcgggcgcggtccctg
cgcctgctgccggaaggacggggcggccggcggccctgtgccggtgctgccgaccacgaa
ctgatcatcgcccgggacaatgtcggccgcttcgccgcacggatcggcttcgcggacgcg
gacaaggccggccggctgcgcgcagcactctccgcctgccggcgccggcccgaccgggag
gactggacggccgaggtggcggaactggtgccggacggcgaggccgaggtcttcgacgtc
cgcatcccgggggcgaacgccttcgaggcaaacggcctcgttgtccacaactgcggcgaa
cagcccctgcccccctacggggcctgcctgctgggctcggtcaatctggccgccctggtg
cgcgatcccttcaccccggcggcccggctggaccgggaggaactggcgcgggtggtgccg
ctggccgtgcggatgatggacaacgtggtggatgtctcccgcttcccgctggaggcgcag
gaggccgaggcgcaggccaagcggcggatcgggctgggcgtcaccgggctggccgacgcg
ctgatcctgtgcggcgtgcgctacggctcggaagccggggtgcggctgacggaggaatgg
ctgcgcgcgatccaggtcgcggcctaccgcacctccgccgccctggcggcggagaagggc
gcctttcccctgttcgaccgggaggcgttcctggagcggcccatggtgcgcgccctgccg
ccggacgtgcgcgaagccatcgccgcgcagggcgtgcgcaacgcgctggtcacctccatc
gcgccgaccgggaccatcagcctgttcgcgggcaacgtctcctccggcatcgagccggtc
ttcgcctacgagtaccagcgtgccgtgctgatgcccgacggcagccggcggacagagacg
gtgcaggacctggcctaccgcctgtaccgggagagaatggggccggacgcgccgctgacc
gacgccttcgtcgatgcccagagcctggagccggcggcgcatctggtgatgcaggcggcg
gcgcagcggcatgtggacagcgccatctccaagaccatcaactgcccggcagacctgccg
ttcgaggcgttcaaggatgtctaccggcaggcctacgagctgggctgcaagggctgcacc
acctatcggccgaacgccgtgacggggtcggtcctgtcggtccaggccacgggcggtgcg
ccggccgccgccccggcccaggcgcccgtccagccgcccgttcaggcgcccgttcaggcg
ccggggccgacatccgcgccgggacgcgcggagccggcgcgcggcgagggtgccgtggtc
tacatgacccggccgctggaccggccggaggccctgcccggccacacctacaaggtgaaa
tggccggacagcgaccacgccctctacatcaccgtgaacgacatcgtgcaggacgggcgg
cggaggccgttcgaggtcttcatcaactccaagaacatggagcactatgcctggacggtg
gcgctgacgcgcatgatctccgccgtgttccgccgcggcggcgacgtctccttcgtggtg
gaggagctgaaggccgtgttcgacccacgcggcggccagtgggtggaggggcgctatgtg
ccctcgctgctggccgccatcggacaggtgatcgagcgccacatgctggaaaccggcttc
ctgccccgccccggggctgcggccggcgccccccgcctgccggccgccaccgggggcccc
gccgcggccgatccggccccagacccggaccccggaccggcgaccgaccccagcgccgcc
cgcctgggccagtgcccccgatgcgcccaggccaccctgctgcggcaggagggctgcgac
ctctgcaccaactgcggctattccaggtgcgggtaa

DBGET integrated database retrieval system