KEGG   Rhodospirillum centenum: RC1_4095Help
Entry
RC1_4095          CDS       T00785                                 

Definition
(GenBank) acyltransferase, putative
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
rce  Rhodospirillum centenum
Pathway
rce00561  Glycerolipid metabolism
rce00564  Glycerophospholipid metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    RC1_4095
   00564 Glycerophospholipid metabolism
    RC1_4095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rce01004]
    RC1_4095
Enzymes [BR:rce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     RC1_4095
Lipid biosynthesis proteins [BR:rce01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   RC1_4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: ACJ01434
UniProt: B6IYR0
Position
complement(4320876..4321673)
Genome map
AA seq 265 aa AA seqDB search
MLVLRSLLFNLVFYVWTMLCCVGLLWMLFIPRRRMIDVLAWYMRTLAWLERTIIGLHYEV
RGLEHLPTHGSFLVGAKHQSMWETMKLHLILDDPAIILKRELLWLPIWGWYAAKSQQIPV
DRSRRGAALSPLVTGARAVAAQGRPIVIFPQGTRLAPGTYRPYKVGIGVLYQDLDLPIVP
MALNSGLFWGRRTIIRRPGTITIEFLPPIPPGLPRDVAMAELEERLETASERLSLAAGGP
PTERPTTPRRIRLRTVARARGQASA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgctgcgctcgctgctgttcaacctggtcttctacgtctggacgatgctgtgc
tgcgtcggcctgctgtggatgctgttcatcccgcgccggcggatgatcgacgtgctggcc
tggtacatgcgcacgctggcctggctggagcgcaccatcatcggcctgcactacgaggtg
cgggggctggagcacctgccgacccacggcagcttcctggtcggggcgaagcaccagtcc
atgtgggagacgatgaagctgcatctgatcctggacgatccggccattatcctgaagcgc
gagcttctctggctaccgatctggggctggtacgcggcgaagtcgcagcagatcccggtg
gaccgcagccgccgcggcgccgccctgtcgccgctggtgacgggagcgcgcgccgtggct
gcgcagggccgcccgatcgtcatcttcccccagggcacccggctggcgcccggcacctac
aggccctacaaggtggggatcggggtgctgtaccaggatctggacctgcccatcgtgccg
atggcgctgaactccggtctgttctggggacgccgcacgattatccgccgccccggcacc
atcaccatcgagttcctgccgccgatcccgcccggcctgccgcgcgacgtcgccatggcc
gagctggaggaacggcttgagacggcgagcgagcggctgtcgctggccgccggcggcccc
ccgaccgaacggccgacgaccccgcgccggatccggctgcgtaccgtggcccgcgcgcgc
gggcaggcgagcgcctga

DBGET integrated database retrieval system