KEGG   Rhodospirillum centenum: RC1_4098Help
Entry
RC1_4098          CDS       T00785                                 

Definition
(GenBank) cell division protein, putative
  KO
K09811  cell division transport system permease protein
Organism
rce  Rhodospirillum centenum
Pathway
rce02010  ABC transporters
Module
rce_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:rce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RC1_4098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rce03036]
    RC1_4098
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rce02000]
    RC1_4098
Chromosome and associated proteins [BR:rce03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    RC1_4098
Transporters [BR:rce02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    RC1_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX
Motif
Other DBs
NCBI-ProteinID: ACJ01437
UniProt: B6IYR3
Position
complement(4322805..4323689)
Genome map
AA seq 294 aa AA seqDB search
MSRRGHYDIPLKRDATGRFLPWIIALMVYLASLSLVAAMVMSDLAARWDTGLSGSLTVQV
RPLSGKDAPTVEARVQDVLKRLEGRPSVTEVRALPHEEAVRLVEPWLGSGALLDDLPVPA
LIDLSLRPDADAKALAAELKGAVPGVEVDDPGDWLAGLRRLAATVQWVSAAVVGLIGAVA
VASVIFAASAGLAVHRAEVELLHVIGASDGYVAGQFQRHVLRLTLIGGAAGLVLALLTLW
GLDAAAQNLTAALLPRLSLTAEQWLSLAGVPAAAALLAAVTARLTVMRALERLP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcggccattacgacatccccctgaaacgcgatgcgaccggacgcttcctg
ccctggatcatcgccctgatggtctatctggcgagcctgtccctggtcgccgccatggtc
atgtccgatctggcggcgcgctgggacaccggcctgtcgggcagcctgacggtgcaggtc
cgccccctgtcgggcaaggacgcgccgacggtggaagcgcgggtgcaggacgtgctgaag
cggctggaaggccgcccatccgtgacggaggtccgcgccctgccgcacgaggaggcggtg
cggctggtcgagccctggctgggcagcggtgccctgctggacgatctgccggtgcccgcc
ctgatcgacctgagcctgcggcccgacgcggacgccaaggcgctggcggcagaactgaaa
ggcgccgtaccgggggtggaggtggacgatccgggcgactggctggccggcctgcgccgg
ctggcggcgacggtgcagtgggtgtccgccgccgtcgtcgggctgatcggcgccgtcgcc
gtcgcctccgtcatcttcgccgccagcgccgggctggccgtccaccgggcggaggtggaa
ctgctgcatgtgatcggcgcctccgacggctatgtcgccgggcagttccagcgccatgtg
ctgcgcctgaccctgatcggcggcgccgccgggctggtcctggcgctgctgaccctgtgg
gggctggacgcggcggcgcagaacctgacggcggcactgctgccgcggctgtcgctgacg
gcggaacagtggctgtcgcttgcgggcgtgccggcagcggcagccctgctggccgcggtc
accgcacggctgacggtgatgcgggccctggagcggctgccatga

DBGET integrated database retrieval system