KEGG   Rhodospirillum centenum: RC1_4099Help
Entry
RC1_4099          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc_ribbon_4 zinc_ribbon_5 DUF3426 Lar_restr_allev zf-CCHC_6 FYVE zinc_ribbon_12
Motif
Other DBs
NCBI-ProteinID: ACJ01438
UniProt: B6IYR4
Position
4323996..4324850
Genome map
AA seq 284 aa AA seqDB search
MILSCPACSKRFLLDAALLGSGRRVKCGNCGHIWHQEPDRAAAAAPAMAPRPAARPAPRP
APAPAPEAASADLSPGFPPDFSLDGSAGFESAPDDDPFAPATSAAPAQRPRPLPLGSNLP
VPLEPERPRRGAMLRWGGLATVVAGLAAGIFFGRDAIVEGWPPAKAFYELVGMPVAPELP
GAGLVLPPDKVRSEFRTIEGTVLLFVSGAIENTSDRERPVPDVLAWAIGADGQRLFSWRI
IPPARVLAPGQSVTFDSRMPERQGEAKAIEYSFVAPEPVPETGF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatcctctcctgcccggcgtgctcgaagcgttttctgctcgatgcggcattgctcggc
agcggccgtcgcgtgaagtgcggcaactgcgggcacatctggcatcaggagcccgaccgc
gccgccgcggctgcgccggccatggcgccccgtccggctgcccggcccgccccccgcccg
gcgccggctcccgcgccggaagcggcgtcggcggatctttcccccggcttccccccggat
ttctccctcgacgggtcggccggcttcgagtcggcacccgacgacgatcccttcgcgccc
gcgaccagcgccgccccggcgcagaggccgcggccgcttcccctcggctccaacctgccg
gtgccgctggagccggagcggccgcgccgcggcgccatgctgcgctggggcgggcttgcc
accgtggtcgccggtctggcggcggggatcttcttcgggcgggatgccatcgtcgaaggc
tggccgccggccaaggcgttctacgagctggtcgggatgccggtggcgccggagctgccg
ggggccgggctggttctgccgccggacaaggtgcgtagcgagttccgcaccatcgagggc
acggtgctgctgttcgtcagcggcgccatcgagaacacctcggaccgggagcgcccggtg
ccggacgtgttggcctgggccatcggcgcggacggtcagcgcctcttctcctggcggatc
attccgccggcccgggtgctggccccgggccagtcggtcaccttcgactcccgcatgccg
gaacggcagggggaggcgaaggcgattgaatacagcttcgtcgcccccgaaccggtgccg
gagaccggcttctag

DBGET integrated database retrieval system