KEGG   Rhodospirillum centenum: RC1_4110Help
Entry
RC1_4110          CDS       T00785                                 

Gene name
etfS
Definition
(GenBank) electron transfer flavoprotein beta subunit
  KO
K03521  electron transfer flavoprotein beta subunit
Organism
rce  Rhodospirillum centenum
Brite
KEGG Orthology (KO) [BR:rce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    RC1_4110 (etfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF CoA_binding_2 TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ACJ01449
UniProt: B6IYS5
Position
complement(4336067..4336816)
Genome map
AA seq 249 aa AA seqDB search
MKILVAVKRVVDYNVKIRVKPDNTGVELANVKMSMNPFDEIAVEEAVRLKEAGKATEIVV
VSIGPAAAQETLRTALAMGADRGVLVQTDAETEPLAVAKALKAIAEKEQPGLVIVGKQAI
DDDANQTGQMLAALLGWPQGTFASKVVAAEGSVAVTREVDGGLETVELKLPAVVTTDLRL
NEPRYASLPNIMKAKKKPIETLTPDQVGVDFSPRLKTLKVTEPAKRKGGVKVADVAALVD
KLRNEARVI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactggtcgccgtgaaacgggtcgttgactacaacgtcaagatccgcgtcaag
ccggacaacaccggcgtcgaactcgcgaacgtgaagatgtccatgaatccgttcgacgag
atcgcggtggaagaggccgtgcgcctcaaggaagccggcaaggcgacggagatcgtggtc
gtgtccatcggtccggccgccgcgcaggagaccctgcgcacggcgctggccatgggggcc
gaccgcggcgtgctggtgcagaccgacgccgagaccgagccgctggccgtggcgaaggcg
ctgaaggccatcgccgagaaggagcagccgggcctcgtcatcgtcggcaagcaggcgatc
gacgacgacgccaaccagaccggccagatgctggccgcgctgctgggctggccgcagggc
accttcgcctccaaggtcgtggcggccgagggctccgtcgccgtcacccgcgaggtggac
ggcggcctggagacggtggagctgaagctgccggcggtggtgaccaccgacctgcgcctg
aacgagccgcgctacgcctcgctgccgaacatcatgaaggcgaagaagaagcccatcgag
accctgaccccggatcaggtgggcgtggacttcagcccccgcctgaagacgctgaaggtc
accgagccggcgaagcgcaagggcggcgtcaaggtggccgacgtggccgcgctggtggac
aagctgcgcaacgaagcccgcgtgatctga

DBGET integrated database retrieval system