KEGG   Rhodospirillum centenum: RC1_4111Help
Entry
RC1_4111          CDS       T00785                                 

Definition
(GenBank) ATP:cob(I)alamin adenosyltransferase, putative
  KO
K00798  cob(I)alamin adenosyltransferase [EC:2.5.1.17]
Organism
rce  Rhodospirillum centenum
Pathway
rce00860  Porphyrin and chlorophyll metabolism
rce01100  Metabolic pathways
Module
rce_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RC1_4111
Enzymes [BR:rce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.17  cob(I)yrinic acid a,c-diamide adenosyltransferase
     RC1_4111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cob_adeno_trans ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: ACJ01450
UniProt: B6IYS6
Position
complement(4337162..4337749)
Genome map
AA seq 195 aa AA seqDB search
MVALTRITTRAGDGGLTFLGDATRVPKTAVRLDTYGTVDEANTLLGAARLYTRGRGGIAG
EADAMLARIQNELLDLAADLCLPERETPRRRPPLRMLPSQVERLEAEIAALDAASLDAAP
GPAPAAGAPFPSGRSPAAALLRLAHAVIRRAERRLAALAREEPVGETARQYTNRLSDHLL
RLARRLDGAEAGAAA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgctgacccgcatcaccacccgcgccggcgacggcggtctgaccttcctgggc
gacgccacgcgcgtgccgaagacggccgtccgactcgacacctacggcaccgtggacgag
gcgaacacgctgctgggcgcggcgcgcctgtacacgcggggccgcggcgggatcgcgggc
gaagccgacgcgatgctggcccgcatccagaacgaactgctggatctggcggccgacctc
tgcctgcccgagcgggagacgccgcggcgccggccgccgctgcggatgctgccgtcgcag
gtggagcgcctggaggcggagatcgcggccctggacgcagccagcctggacgccgccccg
ggacctgctccggcagccggcgcgccgtttccgtccggccgcagcccggctgccgccctg
ctccgtctggcccacgccgtcatccgccgcgccgagcgccggctggcggcgctggcgcgg
gaagagccggtcggagagacggcgcggcagtatacgaaccggctgtccgaccacctgctg
cggctggcccgccggctggatggggcggaagccggtgcggcggcctga

DBGET integrated database retrieval system