KEGG   Rhodospirillum centenum: RC1_4120Help
Entry
RC1_4120          CDS       T00785                                 

Gene name
dsbB
Definition
(GenBank) disulfide bond formation protein, DsbB family, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbB
Motif
Other DBs
NCBI-ProteinID: ACJ01459
UniProt: B6IYT5
Position
complement(4342975..4343484)
Genome map
AA seq 169 aa AA seqDB search
MSDLLSTRPRLIALLLLAGAAGALGAAVTFQYRDGLPPCELCHWQRWAHAAAIGLLLPAP
LALTGQRARGMLLALGGTAFLAGAGIALFHVGVEEHWWQGLSACSVSGPAPDSIEALRAQ
ILGAPLVRCDEIQWSLAGLSMAAWNMVLSLGLALLAFATAWAGYRRRNA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttctttccacccggccccgcctgatcgccctgctgctgctcgccggcgcc
gcgggggcgctgggggcggccgtcaccttccagtaccgcgacggcctgccgccctgcgag
ctgtgccactggcagcgctgggcgcatgccgcggccatcggtctgctgctgcccgccccg
ctggcgctgacgggccagcgtgcccgggggatgctgctggccctggggggcaccgccttc
ctggccggcgccggcatcgccctgttccatgtcggcgtcgaggaacactggtggcagggt
ctgtccgcctgcagcgtcagcggtccggccccggacagcatcgaggcgctgcgggcacag
atcctgggagccccgctggtccgctgcgacgagatccagtggtcgctggcgggcctgtcc
atggccgcctggaacatggtcctgtccctgggtctggcgctgctggccttcgccacggcc
tgggccggctaccgcaggagaaacgcatga

DBGET integrated database retrieval system