KEGG   Ruminococcus champanellensis: RUM_08950Help
Entry
RUM_08950         CDS       T02600                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rch  Ruminococcus champanellensis
Brite
KEGG Orthology (KO) [BR:rch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rch03009]
    RUM_08950
Enzymes [BR:rch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     RUM_08950
Ribosome biogenesis [BR:rch03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RUM_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: CBL17071
UniProt: D4LBS6
Position
982633..983547
Genome map
AA seq 304 aa AA seqDB search
MREVMLTADGSGMRLDKWLTEQLPELSRSGVQHLIEQGAVLCNGKPAAKNLKLREGDGLL
VQIPDPAPLEDVQPQNLPLEIVYEDEALLVVNKPKGMVVHPAAGHPDGTLVNALLYHCQG
RLSTINGVIRPGIVHRIDKNTSGLLMVAKTDFAHQHLAEQIKGHSFTREYEAIACGRFRE
PSGTVDAPIGRSTADRQKMCVTEKNARHAVTHYAVLTQFAKHAHIRCRLETGRTHQIRVH
MRYIGHPIYGDDVYGTAVPGLEGQCLHAKKIGFVHPVSGAYMEFDSALPDYFVQALKKVE
HIHV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtcatgctgacggctgacggcagcggcatgcggttggacaaatggcttaca
gagcagttgccggagttgagtcgttccggggtgcagcatctgatcgagcagggcgcagtg
ctttgcaacgggaaaccggcggcaaagaatctgaagctccgggaaggggacggcctgttg
gtgcagatcccggatcctgccccactggaggatgtacagccccagaacctgccgctggag
atcgtatacgaggatgaagccctgctggtggtgaacaagcccaagggcatggtggtgcat
ccggcggcagggcatccggacggcacattggtgaatgccctgctgtatcactgccagggt
agactgtccaccatcaacggggtgatccgtcccggtatcgtgcaccggatcgacaaaaac
accagcggtctgctgatggtggcgaaaacggattttgcccatcagcatctggcggagcag
atcaaaggccacagctttacccgggaatatgaagccattgcctgcggacggttccgggag
ccttctggcacggtggatgctcccatcggcagaagcacagcggatcggcagaaaatgtgc
gtgacggagaaaaatgcccggcatgcggtgacccattatgcagtgctgacccagtttgca
aagcatgctcatatccggtgtcggctggaaaccgggcgcacccatcagatccgggtacat
atgcgctacatcgggcatcccatttacggagacgatgtgtacggcacggctgtccccggt
ctggagggacagtgcctgcatgccaaaaagatcgggtttgtgcatccggtttccggcgca
tacatggagtttgacagtgcgctgccggattactttgtccaggcactgaaaaaggtggag
catatacatgtttaa

DBGET integrated database retrieval system