KEGG   Ruminococcus champanellensis: RUM_21780Help
Entry
RUM_21780         CDS       T02600                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rch  Ruminococcus champanellensis
Pathway
rch00450  Selenocompound metabolism
rch00970  Aminoacyl-tRNA biosynthesis
rch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RUM_21780
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RUM_21780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rch01007]
    RUM_21780
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rch03016]
    RUM_21780
Enzymes [BR:rch01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RUM_21780
Amino acid related enzymes [BR:rch01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RUM_21780
Transfer RNA biogenesis [BR:rch03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RUM_21780
 Prokaryotic type
   Other AARSs
    RUM_21780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 DUF334
Motif
Other DBs
NCBI-ProteinID: CBL18193
UniProt: D4LEZ8
Position
2303873..2305900
Genome map
AA seq 675 aa AA seqDB search
MSEEKNFHKKPETRPEFPKRAVITGGMPYGNKTLHFGHIGGVFVFADVYARFLRDRIGED
NVIFVSGTDCYGSPIAESYRRKCAEEGFTGSIKDFVAANHQAQKLTLDDYDISLNLFGAS
GLGRTAEIHNQVSDRFIRRLYENGHLTRIATSQFYDAKAGAFLNGRQVIGKCPVEGCNSE
KGYADECDLGHQYMPEMLINPKSTLTGETPIMKKVTNWYFNLTEQNELLNQYVAEIRTQK
NVRPLVSKTIGEFLKPPVIYIKNEFLEQYEACKDQMPEHEFIEEPKKPSFTIAFKKLTDC
DQACVVLAEQGIRYRTGKTLVPFRLTGNVEWGVPAPQLEGEEPLTIWVWPESLWAPISFT
MAYLEQIGHNTEEWKDYWCSKDAQVYQFIGADNIYFYGVAEMGMFMALQGKDNLTTHPAE
GQMQLPILVANNHILFLDKKASSSGSVKPPMAADLLHYYTAEQLRMHYLGLGLGQRSVSF
QPKPLNPNAKPDEADPVLKDGFLLSNVFNRIIRTCIYTTQKYYDGVMPVGEVSAPVLEAA
KKAILDYERFMYRFEFHQATYVLDTYIRKASKLMVKQLGDADKKEDAQLRRQTLIDVFHM
IRTAAVLLHPMAPEGTEKILAYLQLDKSFWSWDHIFEPISFFCGGQDHKLKFLEPRVDFF
TRHPSQFAQSEGTEQ
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggaaaaaaactttcataaaaagccggaaacccgcccggagtttcccaagcgg
gctgtgatcaccggcggcatgccctatggaaataaaacgctgcactttggacacattggc
ggcgtattcgtgtttgcagatgtatacgcccggttccttcgggatcggatcggcgaggac
aacgtgatcttcgtatccggcacggactgctatggctcccctatcgcagaaagctaccgc
cgcaaatgcgcagaggaaggcttcaccggcagcatcaaggattttgttgccgcaaatcac
caggcgcaaaaactgaccctggacgactatgacatcagcctgaacctgttcggtgcatcc
ggacttggccgaactgccgagatccacaaccaggtatccgaccgtttcatccgtcggctg
tatgaaaacgggcacctgacccgcattgccacctcccagttctatgacgcaaaggcaggc
gcattcctcaatggcagacaggtcatcggcaaatgcccggtggagggatgcaactccgaa
aagggctatgcagacgagtgtgatctgggacaccagtatatgccggaaatgctcattaac
cccaaaagcacactgaccggcgaaactcccattatgaaaaaggtcaccaactggtacttc
aatctgacggagcagaacgagctgctgaaccagtatgttgccgagatccgcacccagaag
aatgtgcgccccctggtttccaagaccatcggagaatttctcaagcccccggtgatctat
atcaaaaacgagtttctggagcaatatgaagcctgcaaggatcagatgccggaacacgaa
ttcattgaggaaccgaaaaagccctcctttacgatcgccttcaaaaagctgacggactgc
gatcaggcatgtgtggtactggcagaacaaggcatccggtaccgtaccggcaagaccctt
gtccccttccggcttaccggcaacgtggaatggggcgtacctgcaccccaactggagggt
gaggagcctttgaccatctgggtatggcccgaatctctgtgggcgcccatctccttcacg
atggcatacctggagcagatcggtcacaacacagaggaatggaaggactactggtgctcc
aaggatgcgcaggtataccagttcatcggcgctgacaacatctacttctacggcgtggcg
gaaatgggcatgttcatggctttgcagggcaaggacaacctgaccactcatccggcagag
ggtcagatgcagctgcccatcctggtggcaaacaaccacattctcttcctggataaaaaa
gcaagcagctccggctcggtaaagcctcctatggcagcagacctgctgcactattacacc
gcagaacagttgcggatgcactatcttgggctaggccttggacagcgcagtgtcagcttc
cagcctaagcccctgaaccccaacgcaaagccggatgaagcagacccggtactgaaggac
ggcttcctgctctccaacgtattcaaccggatcatccgtacctgcatctacaccacccag
aaatactacgatggagtcatgccggtgggagaggtttccgcaccggtgctggaggctgca
aaaaaagccattctggattacgaacggtttatgtaccggtttgagttccaccaggccacc
tatgtgctggatacctatatccgcaaggcaagcaagctgatggtcaagcagcttggagat
gcggacaaaaaggaagacgcacagctgcgccgtcagaccctcattgatgtattccatatg
atccgtaccgcagccgtgcttctgcaccccatggcaccggagggaaccgagaaaatcctg
gcgtatttacagctggataagtccttctggagctgggatcatatttttgagcctatttct
ttcttctgcggcggacaggatcacaagctgaaattcctggagcctcgtgtggactttttt
acccggcaccccagtcaatttgcacaaagcgaaggcacggagcagtaa

DBGET integrated database retrieval system