KEGG   Methanocella arvoryzae: RCIX202Help
Entry
RCIX202           CDS       T00526                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5 epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rci  Methanocella arvoryzae
Pathway
rci00521  Streptomycin biosynthesis
rci00523  Polyketide sugar unit biosynthesis
rci01130  Biosynthesis of antibiotics
Module
rci_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RCIX202 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RCIX202 (rfbC)
Enzymes [BR:rci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RCIX202 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_2
Motif
Other DBs
NCBI-ProteinID: CAJ35682
UniProt: Q0W7G1
Position
2549177..2549650
Genome map
AA seq 157 aa AA seqDB search
MADIEGVVIKKLRVIPDERGWLMEILRCDDPMFKQFGQVYVTTAYPGVVKGWHYHKKQTD
NFTCIHGMMKVALYDAREGSPTRGNLMELFVGEKNPILISVPPGVYHGFKGIGTETAYFL
SVPTLPYNYAEPDEYRLPPDSKEIPYDWGLLPGLKHG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatcgaaggcgttgtaataaaaaagctcagggtaatccccgacgagcgtgga
tggcttatggagatcctgcgctgtgatgatccgatgttcaagcagtttggccaggtctat
gtgaccacggcttatcccggcgtcgtaaaaggctggcattatcacaagaaacagactgac
aacttcacctgtatccatggcatgatgaaggtcgcgctctacgatgccagagaaggctct
cccaccaggggtaacctgatggaactcttcgttggcgagaagaaccccatccttatctcg
gtccctcccggagtctaccacggcttcaagggcatcggcactgaaaccgcttacttcctg
agcgtgccgacattaccctataattatgctgagccggacgaataccgcctgcccccggac
tctaaagagattccttacgactggggcttactacctggcttaaaacacggctaa

DBGET integrated database retrieval system