KEGG   Methanocella arvoryzae: RCIX2068Help
Entry
RCIX2068          CDS       T00526                                 

Gene name
mtrA-1
Definition
(GenBank) N(5)-methyltetrahydromethanopterin-coenzyme M methyltransferase, subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
rci  Methanocella arvoryzae
Pathway
rci00680  Methane metabolism
rci01100  Metabolic pathways
rci01120  Microbial metabolism in diverse environments
rci01200  Carbon metabolism
Module
rci_M00357  Methanogenesis, acetate => methane
rci_M00567  Methanogenesis, CO2 => methane
rci_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:rci00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    RCIX2068 (mtrA-1)
Enzymes [BR:rci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     RCIX2068 (mtrA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: CAJ37209
UniProt: Q0W334
Position
complement(1029410..1030198)
Genome map
AA seq 262 aa AA seqDB search
MVEKKEPAKGWPVIKGEFDVGDPKSCVAVATAGSHFGQWPIKAGAAISGPFHTENLGIEK
IVANVISNPNIRFIIITGAEVKGHISGDALECLHKNGLKGGRIVGAKGAIPFIENLDDKA
VKRFQEQVQTVYMIDVEDEQKITAAIKDCIAKDPGAFAGEPMLLEIKETKIGEEEEEAGG
EVVAGAVPAGGVVSGMASEIMMIQSRIRLIKQDVKGIGYLNKFAMGWYAGKMEGVMIGLV
LSLLLLALLFPQGVDLSTLRIK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaagaaagagccagcaaagggatggccggttattaagggcgagttcgatgtt
ggtgacccgaagagctgtgttgcagtagcgactgcgggttcccacttcggccagtggccg
attaaggctggtgctgccatttcgggtccgttccacactgagaacctgggtatcgagaag
attgtggctaacgttatctcgaatccgaacatccggtttatcattattaccggtgctgag
gttaagggccacatttcgggcgatgctctggagtgtctgcacaagaatggtcttaagggc
ggcaggattgtcggtgctaagggtgctattccctttattgagaaccttgatgacaaggct
gtcaagaggttccaggagcaggtccagactgtctacatgattgatgtagaggatgagcag
aagattacggctgccatcaaggactgtatcgctaaggatcccggtgcgtttgccggtgag
ccgatgctgctcgagatcaaggaaaccaagatcggcgaggaagaggaagaagccggcggc
gaagttgtcgcaggcgcagtccccgcaggcggtgtcgtcagcggcatggcctctgagatc
atgatgatccagagcaggatcaggctcatcaagcaggatgtcaagggcatcggctacctg
aacaagttcgccatgggctggtacgcaggcaagatggaaggcgtcatgatcggcctcgtt
ctgtccctgctattgctcgctctgctgttcccgcagggagtggacctatcgacattgagg
attaagtag

DBGET integrated database retrieval system