KEGG   Methanocella arvoryzae: RRC109Help
Entry
RRC109            CDS       T00526                                 

Gene name
porC-2
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00020  Citrate cycle (TCA cycle)
rci00620  Pyruvate metabolism
rci00633  Nitrotoluene degradation
rci00640  Propanoate metabolism
rci00650  Butanoate metabolism
rci00680  Methane metabolism
rci00720  Carbon fixation pathways in prokaryotes
rci01100  Metabolic pathways
rci01120  Microbial metabolism in diverse environments
rci01130  Biosynthesis of antibiotics
rci01200  Carbon metabolism
Module
rci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RRC109 (porC-2)
   00020 Citrate cycle (TCA cycle)
    RRC109 (porC-2)
   00620 Pyruvate metabolism
    RRC109 (porC-2)
   00640 Propanoate metabolism
    RRC109 (porC-2)
   00650 Butanoate metabolism
    RRC109 (porC-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RRC109 (porC-2)
   00680 Methane metabolism
    RRC109 (porC-2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RRC109 (porC-2)
Enzymes [BR:rci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RRC109 (porC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: CAJ37879
UniProt: Q0W164
Position
complement(411797..412333)
Genome map
AA seq 178 aa AA seqDB search
MLEIRFHSRGGQGGVTASKLLAQAAFLEGKYSTAFPLYGAERRGAPVTSFTRISEDEIKI
SSQIYQPDIVVVLDDSILDLVNVTDGLKSGGLLIVNTNHHAKLPQGDFKVATVNVTDIAL
KMGLVLSGNPILNTPILGALAKLNVVGLDSALAAIKETFSDERNVNAAREAYEKVVMC
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaataaggttccactccagaggagggcagggcggcgtgaccgcatccaaactg
ctcgcgcaggcggctttcctcgaaggcaagtacagtactgccttcccgctctatggcgca
gagcgccggggagcgccagttacgtccttcacccgtataagcgaagatgagatcaagatc
tccagccagatttaccagcccgacatcgtcgtggtgctggacgactcgatcctcgatctg
gtgaacgtcacagacgggctcaagtccggaggactgctgattgttaataccaaccaccac
gcgaagctgccccagggcgacttcaaggtggctactgtgaatgtgacagacatcgctttg
aagatggggctggtcctgtcaggcaacccgatcctgaacacgcccatccttggagcgctg
gcgaagctaaacgtggtcggcctggactcggcactggccgcgatcaaggaaacgttcagc
gacgagagaaacgtgaacgcagccagggaagcatacgagaaggtggtcatgtgctga

DBGET integrated database retrieval system