KEGG   Methanocella arvoryzae: RRC499Help
Entry
RRC499            CDS       T00526                                 

Gene name
pfkA
Definition
(GenBank) ATP-dependent 6-phosphofructokinase (PFK-A family)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rci  Methanocella arvoryzae
Pathway
rci00010  Glycolysis / Gluconeogenesis
rci00030  Pentose phosphate pathway
rci00051  Fructose and mannose metabolism
rci00052  Galactose metabolism
rci00680  Methane metabolism
rci01100  Metabolic pathways
rci01110  Biosynthesis of secondary metabolites
rci01120  Microbial metabolism in diverse environments
rci01130  Biosynthesis of antibiotics
rci01200  Carbon metabolism
rci01230  Biosynthesis of amino acids
rci03018  RNA degradation
Module
rci_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:rci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RRC499 (pfkA)
   00030 Pentose phosphate pathway
    RRC499 (pfkA)
   00051 Fructose and mannose metabolism
    RRC499 (pfkA)
   00052 Galactose metabolism
    RRC499 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    RRC499 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RRC499 (pfkA)
Enzymes [BR:rci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RRC499 (pfkA)
Protein phosphatases and associated proteins [BR:rci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RRC499 (pfkA)
Messenger RNA biogenesis [BR:rci03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RRC499 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAJ38191
UniProt: Q0W0A2
Position
complement(81128..82090)
Genome map
AA seq 320 aa AA seqDB search
MRTIGVVTSGGDAPGMNAAIRAIVRVAQAHGIAVIGFERGWEGLIYDNVMSLTPRSVSGI
IQQGGTILRTSRNKEFMTDEGMQKASVTLANNKVDGLIVIGGDGSFRAAHEFSKKTDTRI
AGIPATIDNDVYGTDETIGFDTAVNTGVTEIDKIRDTATSLDRVFIVEVMGRTRGFLAAM
IGLTVGAEIILVPEVKFQPEEVCDTILKNSAAGKKSGIIVAAEGIGDTHALAKEIQEHTR
IETRLSVLGYAQRGGHPTARSRFLASVFGKAAVEFLADGKENLIAALQHGKVTGISFDES
CCKSKELDLRLLKLARELSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccatcggcgtcgtaaccagcggaggggatgcacccggcatgaatgcggctatt
cgggcaatcgtccgcgtagcccaggcacatggcatagctgtgattggtttcgagcggggc
tgggaaggcctgatctacgataacgtaatgtcgcttacaccccggtccgtaagcggtatt
attcagcagggcggcacgattctgaggacgtccaggaataaggagttcatgacggacgaa
ggcatgcaaaaagccagtgttactcttgccaacaacaaggtcgacgggctgatcgtcatc
ggcggagacggctctttccgggcggcgcacgagttcagcaaaaaaaccgataccagaatt
gccggcatccccgcgaccatcgataacgatgtctacgggaccgacgagacaatcggcttc
gatacggccgtcaacaccggtgtaacagagatcgacaagatcagggatacggcaacatcg
ctggacagagtcttcatcgtcgaagtcatgggccggaccagaggcttcctcgccgcgatg
ataggcctgaccgtaggcgcagagatcatcctggtgccggaggtcaagttccaacctgaa
gaggtctgcgacacgatcctaaaaaatagcgctgccgggaaaaagtcaggcatcatcgta
gctgcggaaggcatcggtgatacccatgccctggcaaaggagatacaggagcataccaga
atcgaaacccggctcagcgtcctgggatatgcccagagaggcggacacccgaccgcccgg
agccgattcctggccagcgtcttcgggaaagcggctgtagaattcctggcggacggaaag
gaaaatctgatcgcagctctgcagcatggaaaagtcaccggcatcagctttgacgagtcc
tgctgtaagtcgaaagagctggacctcaggctgctgaagctggcccgggagctgtcgaaa
tag

DBGET integrated database retrieval system