KEGG   Rickettsia canadensis McKiel: A1E_00455Help
Entry
A1E_00455         CDS       T00603                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
rcm00473  D-Alanine metabolism
rcm01100  Metabolic pathways
rcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A1E_00455
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A1E_00455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rcm01011]
    A1E_00455
Enzymes [BR:rcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A1E_00455
Peptidoglycan biosynthesis and degradation proteins [BR:rcm01011]
 Precursor biosynthesis
  Racemase
   A1E_00455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABV73041
UniProt: A8EXF8
Position
105806..106873
Genome map
AA seq 355 aa AA seqDB search
MSLCTLAINLSAIKNNYFLLQDICKTSLVGAVVKADGYGLGAVQISKALIEENCRHFFVA
SSEEGVNVRKALGIDVNILVLNGVFEHDALELIEYNLIPILNNLKQIEIWQQFGNLKNLL
LPCYLHFNTGINRLGLSSNEIEQLINNRDLLKGLNLQYIISHLAISEEIDNPYNLEQLNK
FKAYLRYFPSIKASLANSGGIFLGQDYHFDLVRPGAALYGLNPLMQNPVTLKAPIIHLQN
LTLDSHIGYNMTFTTKRDSVIATLPLGYADGYSRNFSNQGKVFINGRSVPIVGRVSMDLI
NIDVTDLPPSDIFLGQEVEIIGNHCTPDKIASIIGTIGYEVLTSLGNRYRRKYTR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtgtactctagcaataaatctatctgcaataaaaaataattactttttatta
caagatatttgcaaaacctcgttagtcggtgctgtcgttaaagctgatggttacggtctt
ggagcagtacaaatttctaaagctttaatagaagaaaattgtagacatttttttgtagct
tcaagtgaagaaggagttaatgtacgcaaagctttaggcatagatgttaatattttggtc
ttaaacggtgtttttgagcatgatgctttagagcttatagaatataatttaatacctatt
ctaaataacttaaagcaaatcgaaatttggcaacaattcggtaatttgaaaaacctatta
ttaccttgttatttacatttcaataccgggattaatcgtctcggcttaagctctaatgag
atagagcagttaattaataatcgtgatttgttaaaaggactaaatttacaatatattata
agccatctagctatatccgaggaaatagataatccttataatctagaacaattaaacaaa
tttaaagcttatttacgatatttcccaagtataaaagcaagtcttgctaattctggcggc
atatttttagggcaggattaccattttgatttagtaagaccaggggctgctttatacggt
cttaaccctttgatgcaaaatcccgtaaccttaaaagcccccataattcacttacagaat
ttgacactagatagccatatcggttataatatgacttttaccactaagcgtgatagtgtt
attgcaacattaccgcttggttatgccgacggatatagccgtaattttagtaatcaaggt
aaagtgtttattaacggtcgcagcgttcctatagtagggcgagtatcgatggatttgata
aatattgatgttaccgatctaccaccttctgatatttttctagggcaggaagtggaaatt
attggcaatcattgtacgcctgataaaatagcgagtattattggtactatcgggtatgag
gtattaactagtcttggtaatcgatatagaagaaaatatactagatga

DBGET integrated database retrieval system