KEGG   Rickettsia canadensis McKiel: A1E_01390Help
Entry
A1E_01390         CDS       T00603                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
rcm00564  Glycerophospholipid metabolism
rcm01100  Metabolic pathways
rcm01110  Biosynthesis of secondary metabolites
Module
rcm_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A1E_01390
Enzymes [BR:rcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     A1E_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ABV73223
UniProt: A8EXZ0
Position
312893..313588
Genome map
AA seq 231 aa AA seqDB search
MKHYNDLFKIIHREGYIFIASFALVSFLLASFNTKLGCIGFIATAWCIYFFRNPDRYVPI
NDDLVISPADGVIQEIKEALPPPELGLGDVAMIRVSIFLNIFNVHVNRIPANGKILALHY
NPGKFFNASLDKASIYNERQSVLMETDQGQKIIFVQIAGLIARRIICDLEEGNEVKTGER
YGIIRFGSRVDVYLPLKTALLVSKGQTTIGGETIIADFGRKKTAQFKFKRK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactataatgatttatttaaaattattcaccgcgaaggatatatctttattgct
agttttgcattagtaagttttttattagcatcatttaatacaaaacttggctgtattggg
tttattgctactgcgtggtgtatttacttctttcgtaatcccgatcgatatgtgcctata
aatgatgatttggtcataagtcctgcagatggagtaattcaagaaattaaggaagccttg
cctccgccggaattagggcttggtgatgtggcaatgattagagttagtatttttctaaat
atttttaatgtacatgttaatagaattccagcaaacggaaaaattttagctcttcattat
aatccaggaaagttttttaatgcttcacttgataaagctagtatttataatgaacgtcaa
tcagtattaatggaaactgatcaagggcagaaaattatttttgttcaaatagctggactt
atagcaaggcgtataatttgtgatttagaagaggggaatgaagttaaaacaggtgagcgg
tacggtataattcgttttggtagtagagtagatgtttatctaccgttgaaaacagcttta
ttagtgagtaaggggcagaccactataggcggtgaaactatcattgctgattttggacgt
aaaaaaacagcacaattcaagtttaagaggaagtag

DBGET integrated database retrieval system