KEGG   Rickettsia canadensis McKiel: A1E_02755Help
Entry
A1E_02755         CDS       T00603                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
rcm00010  Glycolysis / Gluconeogenesis
rcm00020  Citrate cycle (TCA cycle)
rcm00620  Pyruvate metabolism
rcm01100  Metabolic pathways
rcm01110  Biosynthesis of secondary metabolites
rcm01120  Microbial metabolism in diverse environments
rcm01130  Biosynthesis of antibiotics
rcm01200  Carbon metabolism
Module
rcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1E_02755
   00020 Citrate cycle (TCA cycle)
    A1E_02755
   00620 Pyruvate metabolism
    A1E_02755
Enzymes [BR:rcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A1E_02755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT DUF5421
Motif
Other DBs
NCBI-ProteinID: ABV73495
UniProt: A8EYR2
Position
complement(583562..584818)
Genome map
AA seq 418 aa AA seqDB search
MPIKILMPALSPTMTEGNLSRWLKNEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEDIDDINGFIAKNSSVLPSLKADADANLLKSTEDIAVQY
SNVEEQVAVTNHNKSKIFASPLAKRLAKIQNIRLESVKGSGPHGRIIKQDILSYTPSTVP
NKIVIRNPEEYHLVPNNNIRKIIAKRVLESKQAVPHFYLSIECNVDKLLEIREDINKSFS
EDNSTRISVNDFIILAIAKALQEVPNANASWGKDAIRYYNNVDIAVAVAIENGLVTPIVK
NADQKNIIELSHEMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCI
MGVGSSSKRAIVKNDQINIATIMDVTLSADHRVIDGVVGAEFLAAFKKFIERPALMLL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctatct
aggtggttaaaaaatgaaggggacaaagttaatcccggggaagtaattgccgaaattgaa
accgacaaagcaacgatggaagtagaagcagtagacgaaggtatactggccaaaatagtt
attccacaaaatagtcaaaatgtacctgttaactctttaattgctgtgttaagcgaagag
ggagaagacatagatgatattaatgggtttattgcaaaaaatagtagtgtattaccatca
ctgaaagcagatgcagatgctaatcttctaaaatccactgaggatatagctgtgcaatat
tctaatgtagaagagcaggtagcagttacaaatcataacaaaagtaaaatattcgcctca
ccccttgcgaaaaggcttgcaaaaattcaaaatattagacttgagagtgtaaaaggtagt
ggtccgcacggtagaataatcaaacaagatattttatcatatactcctagcactgttcct
aataaaatagttattaggaatcccgaagaatatcatttagtaccaaataataatattcgc
aagattatagctaaacgtgtacttgaatctaaacaagcagtcccacatttctatttatcg
atagaatgtaacgttgataaattattagaaataagagaagacattaataaatctttttct
gaagataattcaacaaggatatcggtcaatgattttattattttagcaatagccaaagct
ttgcaagaagtgccgaatgctaatgctagttgggggaaagatgcgattagatattacaat
aatgtggatattgcggtagcagtagcaattgagaatgggcttgttacgccgatagttaaa
aatgctgatcaaaaaaatattatcgagctatctcatgaaatgaaagaattaataaagaaa
gcaaaagataataaattaacccctgaagagtttcaaggtggaggatttactatttctaac
ctcggtatgtacggtattaagaattttaatgctataataaatccaccgcaaagttgtata
atgggggttggtagtagctcaaaacgtgctatagtcaaaaatgatcaaataaatatagca
acaattatggacgtaactctttctgctgatcaccgagtaatagacggagtagtcggtgcc
gagttcttggcagcatttaagaagttcatagaaagacccgctttgatgttgttataa

DBGET integrated database retrieval system