KEGG   Rickettsia canadensis McKiel: A1E_05580Help
Entry
A1E_05580         CDS       T00603                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
rcm00230  Purine metabolism
rcm00240  Pyrimidine metabolism
rcm01100  Metabolic pathways
rcm03030  DNA replication
rcm03430  Mismatch repair
rcm03440  Homologous recombination
Module
rcm_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1E_05580
   00240 Pyrimidine metabolism
    A1E_05580
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A1E_05580
   03430 Mismatch repair
    A1E_05580
   03440 Homologous recombination
    A1E_05580
Enzymes [BR:rcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A1E_05580
DNA replication proteins [BR:rcm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A1E_05580
DNA repair and recombination proteins [BR:rcm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     A1E_05580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABV74027
UniProt: A8F094
Position
complement(1145134..1145598)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSVLLLIEKCYYSDLKSVILTTDKEQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLIIISPIDIGKILQVKDYIEVFKRIIIITHFLE
DLKELTVKVNKFTEQENKIDCFKQDMRGAWNKVK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattactgctaaaatcggtattactt
ctgatagaaaaatgttattactctgatcttaaaagtgttatacttaccactgataaagaa
cagcaggaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaagcttgatccacagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttatcattatttcacccatagatataggaaaaatttta
caagttaaagactatatagaagtttttaaaagaataattattataactcattttctggaa
gatttaaaagaattaacagttaaagtaaataaatttactgagcaggaaaataaaatcgat
tgttttaaacaagatatgcggggtgcatggaataaagtaaaataa

DBGET integrated database retrieval system