KEGG   Rosa chinensis (China rose): 112163963Help
Entry
112163963         CDS       T06020                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112163963
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112163963
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112163963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind Pkinase_fungal UPF0223 APH
Motif
Other DBs
NCBI-GeneID: 112163963
NCBI-ProteinID: XP_024155988
Position
1
AA seq 504 aa AA seqDB search
MTDADVVHGGVGLEDCTEARCSSYGPAIRFPFRLKGRQPVHCGYQGFDLSCTNGNQTLLE
MPSSSKLFVTEIDYTSQTIDEEPALDCLDRDIFNHSSSSAFKYVGNISLFSCPPSTVHDY
KDALAYAEGFSYMILHWSMPSCQHCEEKGKLCLLKNEFTNPTDPQTQCLDVPKAKGHKLG
APTIKILGYCTVSIILIMTGTIICYVYSSVKREEENQLRIKRFLDDYKALKPSRYSYADI
KRITKQFKEKRGQGAYGTVFKGRVSSELLVTVKILNNSNENGEDFINEMGTMGQIHHVNV
VRLVGYCADGFIRALVYEFLPNGPLHNFLSSADNENSFLGWDKLQDIALGIAKGIEYLHQ
AGCEQQILHFDIKPHNVLLDYDFTPKVSDFGLAKLCSKDQSAVSMTAARGTMGYIALEFF
SRNFGNVSYKADVYSFGTLLLEMVGGRKNFKVMEDSTSQVYFLEWIYNLLEQGNDLRIHI
GDQGNVEIARKLAIVGLWCIQCTQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgcagatgttgtgcatggtggagtaggtcttgaagattgcacagaagcaaga
tgtagcagctatggcccagctatccggttcccatttcgacttaaaggtaggcaaccggtc
cattgtggttaccagggctttgatctttcatgcaccaatggcaatcagacactgcttgag
atgccatcatcatctaagctctttgttacagagattgattacacatcacagacaattgac
gaagaacctgcacttgattgcttggatagagacattttcaaccacagttcttcttctgcc
ttcaaatatgtaggcaacataagccttttcagttgcccaccatcaactgtgcatgactac
aaagatgctcttgcatacgcagaaggtttctcatacatgattctccactggtccatgcca
tcttgtcaacattgtgaagagaagggcaagctatgtctgctgaagaatgaattcacaaat
ccgacagatcctcaaactcaatgcttggatgtacccaaagccaaaggtcacaaacttgga
gctccaactataaagatattaggttattgcacagtttctattattcttataatgacggga
acaataatctgctatgtctatagctctgtcaaaagagaagaagaaaatcagctgagaatt
aaaagatttttggatgactacaaagctcttaagccaagcagatattcttatgcagatatt
aagaggataacaaagcagttcaaggaaaagcgaggtcaaggggcctatggaactgtgttt
aaaggtagagtttcctctgaattacttgttactgtgaaaatcctcaacaattcaaatgag
aatggggaagattttattaatgaaatgggcacaatgggtcaaatccaccatgtcaatgtg
gtacgcttggttggttactgtgctgatggctttatacgagctcttgtttacgaattctta
ccaaatggtccactccataatttcttatcatcagcagataatgagaattcgttccttggc
tgggataagttgcaagatattgctttaggtatagccaaaggaattgaatatcttcaccaa
gctggttgtgaacaacaaatcctccactttgacatcaaaccccataatgtgttgctagac
tatgatttcactccaaaagtttccgattttggtttagccaagttgtgctccaaggatcaa
agcgccgtatccatgactgcagcgaggggaaccatgggctatattgcactagaattcttc
tcaaggaactttggtaacgtgtcatataaggcagatgtttatagttttggaacattgctt
cttgaaatggttggaggcagaaagaattttaaagtcatggaagactcaaccagccaagtc
tacttcctagaatggatctataatctcttagaacaagggaacgacctgcgcatccatatt
ggggaccaaggaaatgttgaaattgctaggaaacttgcaattgtgggtctatggtgcatc
caatgcacccaatag

DBGET integrated database retrieval system