KEGG   Rosa chinensis (China rose): 112164305Help
Entry
112164305         CDS       T06020                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00450  Selenocompound metabolism
rcn00970  Aminoacyl-tRNA biosynthesis
rcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    112164305
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    112164305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rcn01007]
    112164305
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rcn03016]
    112164305
Enzymes [BR:rcn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     112164305
Amino acid related enzymes [BR:rcn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   112164305
Transfer RNA biogenesis [BR:rcn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    112164305
 Prokaryotic type
   Other AARSs
    112164305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 112164305
NCBI-ProteinID: XP_024156288
Position
1
AA seq 649 aa AA seqDB search
MGGLKLPIPGQRNVLITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNTVYICGTD
EYGTATETKAMEDKCSPKEICDKYHAIHRQVYDWFNISFDEFGRTSTPEQTEVCQAIFNR
LLENNWLSDNTMQQLYCDTCTRFLADRLVEGTCPTQGCDYTSARGDQCENCGKLLNPTEL
KDPKCKVCKSTPRIRDTNHLFLELPLLKDRLEEYINKMSVEGSWSQNAIQATNAWLREGL
KQRCITRDLKWGVPVPHDNFRDKVFYVWFDAPIGYVSITKCYTPDWEKWWKNPEDVELYQ
FMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKSKGIGVFGNDAKDT
NIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLSFVAKPSGQGYD
SIIPDGQDAISDPLTEKIAEKVGKYVEQYVEAMEKVKLKQGLKLAMSISSEGNAYLQESR
FWKLYKEDQPRCSIVMRTAVGLVHLLACLLEPFMPSFSVKVFKQLNLPPETHISLCDDKG
DTDRARRPWEIVPRGHKIGKPEPLFKELNNDEVDSLRKKFAGSQADRKEREEAEAVKLAE
QLKKSKVSDKSGISMSFLGLVSNLCVCWSGTESEGMRPLQPEASDHTAY
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcctcaagctccccatccccggccaacgcaacgtcctcatcaccagcgcgctg
ccgtacgtcaacaacgtccctcatctcggcaacatcatcggctgcgttctcagcgccgac
gtcttcgctcgctactgccgtctccggggatacaacaccgtctatatctgcggcaccgat
gagtacggcaccgccaccgagaccaaagccatggaggacaagtgtagccccaaggagatc
tgcgataagtaccacgcgattcatcggcaggtgtatgactggttcaatataagttttgac
gaattcgggcgaacttcgacgccggagcagacggaggtgtgccaagccattttcaatagg
ctgctggagaataattggctctctgacaacacgatgcagcagctctactgtgatacttgc
acacggttcttagccgacaggctcgtggaggggacgtgcccaacgcaaggttgtgattat
acttctgcaagaggagatcagtgtgagaactgtgggaagcttttaaaccctaccgaatta
aaggatccaaagtgcaaggtctgtaagtcgactccacggattcgtgatacaaaccatttg
tttctggaattgcctttgctgaaggataggttggaagagtatattaataaaatgtcagtg
gaggggtcttggagccagaatgccattcaagcgacaaatgcgtggctcagagaggggctt
aaacaacggtgtatcaccagggatctgaagtggggggttccagttccacatgataacttc
agggacaaggttttctatgtgtggtttgatgcgcctattggatatgtttcaattactaaa
tgctacactccagattgggagaaatggtggaagaatccagaggatgtggagttgtatcag
tttatgggcaaagataatgtgccattccacacggtgatgtttccttccacgcttcttgga
actggtgaaaattggactttaatgaagacaattagtgttactgaatacttgaactatgaa
gcaggaaagttttccaagagtaaagggattggagtatttggaaacgatgccaaagataca
aacattcctgttgaagtatggcgatattacttgctaaccaataggcccgaggtgtcggat
acattatttacatgggcggatttgcaagcgaagctcaacagtgaattgctgaataatttg
ggcaacttcattaaccgagttttgagttttgttgccaaaccttcaggtcaaggatatgac
tccattattccagatggtcaagatgccatctctgatcctttgacagagaaaatagctgag
aaagtgggtaaatatgtggagcaatatgtagaggccatggagaaggtaaaactaaagcaa
ggactcaaactagcaatgagcatttctagtgaagggaatgcatatctgcaagaaagtcgg
ttctggaagctttacaaggaagaccaacctcgctgctccattgttatgagaactgcagtg
gggctagtgcatcttcttgcttgcttattagaacccttcatgccatctttttctgttaag
gtatttaagcagcttaatctgcctcctgagacgcacatatcactttgtgatgataaaggt
gatactgatagggcaagacggccatgggagattgtacctagaggtcacaagattgggaaa
ccagagccgttgttcaaggaattgaataatgatgaagtagattctctaaggaagaagttt
gctggaagtcaggccgatagaaaggaaagggaagaagctgaagcagtgaagttggctgag
cagctcaagaaatcaaaagtttcagacaagagtggaatttccatgagttttctcggatta
gtatctaatttatgtgtttgttggtctgggacagaatcggaaggtatgcgtcctttgcaa
cctgaagccagcgaccatacagcatattaa

DBGET integrated database retrieval system