KEGG   Rosa chinensis (China rose): 112167438Help
Entry
112167438         CDS       T06020                                 

Definition
(RefSeq) calcium/calmodulin-regulated receptor-like kinase 1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112167438
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112167438
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112167438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1 ESM4 Haspin_kinase MethyltransfD12 LapA_dom
Motif
Other DBs
NCBI-GeneID: 112167438
NCBI-ProteinID: XP_024160230
Position
5
AA seq 430 aa AA seqDB search
MKGEPVGLIIGVSIGVVIGVLLAISGFFCIRYHRKRMQIGNSSSRRAANLPIRANGADSC
TILSDSTLGPDSPVKSERTGGSFWLVEGFKRSNVVSMSGIPEYSYKDLQKATYNFTTLIG
QGAFGPVYKAQMLTGETVAVKVLATDSKQGEKEFQTEVKLLGRLHHRNLVNLIGYCAEKG
QHMLIYVYMSKGSLASHLYDEKNDPLSWDLRVHVALDVARGLEYLHDGAVPPVIHRDIKS
NNILLDESMRARVADFGLSREEMVDKHAAIRGTFGYLDPEYISTRNFTKKSDVYSFGVLL
FELIAGRNPQQGLMEYVELAAMNTEGKFGWEEIVDSRLNGNFDVQELNEVAALAYKCVSR
SPKKRSSMRDIVQVLSRMLKVRHNRKHHAKSLSSTAGEVMIDVNQPETKIQMAEHQRDES
MDSTADTYDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgagccagttggactgatcattggggtttctataggggtagtgattggagtg
cttttggcaatttctgggttcttctgcattaggtaccataggaagcgtatgcaaataggg
aacagcagttctcgaagggcagcaaatcttcctattcgtgctaatggcgccgactcttgt
acaattttgtcagactcgacacttggtccagactcacctgtcaaatctgaacggactggt
ggttccttctggcttgttgaaggatttaagaggagtaatgtagtctcaatgtctggaata
cccgagtattcttacaaggatctgcagaaagcaacctataattttacaacattgataggg
caaggtgcatttggtcctgtgtacaaagctcagatgttaacgggtgagactgttgccgtt
aaagtgcttgcaactgattctaagcaaggggagaaagagtttcagacagaggttaagtta
ttgggaagattgcatcacaggaacctcgtgaacttaattggatactgtgcagaaaaaggc
caacatatgcttatttatgtctacatgagtaaagggagtttggcctctcatttgtatgat
gaaaagaatgacccattgagctgggatttgagggttcatgtagctttagatgttgcaagg
ggcttggagtatcttcatgatggagcagttcctcctgtaatacaccgggatatcaaatcc
aacaatatcctgttggatgaatccatgagagccagggtagctgattttggactttcaaga
gaagagatggtggacaaacatgcagctattaggggaacctttggctatctagatcccgag
tatatctctactagaaatttcaccaagaaaagtgatgtttacagctttggagttctgctg
tttgaactcatagctggaagaaatcctcaacagggtctgatggaatatgtggagcttgcg
gcaatgaatacggaggggaaatttgggtgggaggaaattgtggattcccgtcttaatggg
aactttgatgtgcaagagctcaacgaagtggcagctcttgcatataaatgtgtcagccgc
tccccaaaaaagcggtcttccatgagagacattgtacaagtgctatcacgaatgctgaaa
gtgaggcacaatagaaagcaccatgcgaaatcattgtcatccacagcaggggaagttatg
attgacgtgaaccaaccagaaaccaaaattcaaatggctgaacaccaaagagatgagtct
atggacagcacagccgatacatatgatttatag

DBGET integrated database retrieval system