KEGG   Rosa chinensis (China rose): 112167642Help
Entry
112167642         CDS       T06020                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione hydrolase 3-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00430  Taurine and hypotaurine metabolism
rcn00460  Cyanoamino acid metabolism
rcn00480  Glutathione metabolism
rcn00590  Arachidonic acid metabolism
rcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112167642
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    112167642
   00460 Cyanoamino acid metabolism
    112167642
   00480 Glutathione metabolism
    112167642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rcn01002]
    112167642
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rcn04090]
    112167642
Enzymes [BR:rcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     112167642
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     112167642
    3.4.19.14  leukotriene-C4 hydrolase
     112167642
Peptidases and inhibitors [BR:rcn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   112167642
CD molecules [BR:rcn04090]
 Proteins
  112167642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 112167642
NCBI-ProteinID: XP_024160457
Position
5
AA seq 340 aa AA seqDB search
MEDLRNYKVNVTDAMTANVLGYTISGMPPPSAGTLGLSMILNIFNSYGNSDAANGDLGLH
RLIEALKHMFAIRMNLGDPAFVDTHEYASDMLSPSFAKEIQQKIFDNTTFPPEYYSYRWS
QLRDHGTSHFCIVDADRNAVSMTTTVNYPFGGGVLSPSTAIVLNNEMGDFSIPTDISPDH
LPPAPSNFIEPIKRPLSSMTPIIVTKDNQLVGVLGGSGGLNIXVTQVFINYFILGMEPLA
AVQSPRVYHRLIPNIVSYENWTVSDGNHIELSDERKLFLQEQGHELXAKAGGAITQLIVQ
RLGNPIQMGRKCGRSSNENVFHGILTAVSDPRKDGRPAAV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttgaggaattataaagtgaatgttacggatgccatgactgcaaatgtgttg
ggatatactatatcaggaatgccacctccttcagctggaactttggggctttctatgatt
ctgaacatcttcaacagctatggaaattcagatgcagcaaacggagatcttggtctgcat
cgtctgattgaagcattgaaacacatgtttgcaatccgaatgaacttgggtgatcctgct
tttgtagatacccatgaatatgcatctgatatgctttctccatcctttgctaaggaaatt
cagcagaagatatttgacaacacaactttcccaccagagtactattcatacaggtggagt
cagctcagagatcacggaacaagtcatttctgcatagtagatgcagacagaaatgcggta
tcaatgacaaccactgtaaactatccttttggaggtggagtactctctccttctactgca
attgtgctcaacaatgagatgggtgacttctcaattcccactgacatatcgccagaccat
ctccctcctgctccgtcaaatttcattgaaccaatcaaaagacctttatcttccatgact
cctattatagtcacaaaggataatcaattggttggtgtgcttggaggtagtggtggtttg
aacattnatgtaactcaggtgtttatcaattatttcatattggggatggaacctttagcc
gcagttcaaagtccaagggtctaccacaggctaataccaaacatagtgtcctatgaaaac
tggactgtaagcgatggaaatcatattgagctttcagacgaaagaaagctcttcttgcag
gagcagggtcatgaattgncagctaaagccgggggagccatcactcagctcattgttcaa
agacttggaaaccctattcagatgggcaggaaatgtggtagaagttcaaatgaaaacgtt
ttccatggtatactcactgctgtaagtgaccctagaaaagatggaaggcctgcagctgta
tga

KEGG   Rosa chinensis (China rose): 112184584Help
Entry
112184584         CDS       T06020                                 

Definition
(RefSeq) glutathione hydrolase 3-like
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00430  Taurine and hypotaurine metabolism
rcn00460  Cyanoamino acid metabolism
rcn00480  Glutathione metabolism
rcn00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112184584
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    112184584
   00460 Cyanoamino acid metabolism
    112184584
   00480 Glutathione metabolism
    112184584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 112184584
NCBI-ProteinID: XP_024178610
Position
2
AA seq 128 aa AA seqDB search
MEDLRNYKVNVTDAMTANVLGYTISGMPPPSAGTLGLSMILNIFNSYGNSDAANGDLGLH
RLIEALKHMFAIRMNLGDPAFVDTHEYASDMLSPSFAKEIQQKIFDNTTFPLEYYSYRHD
HPTFYSLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttgaggaattacaaagtgaatgttacggatgccatgactgcaaatgtgttg
ggatatactatatcaggaatgccacctccttcagctggaactttggggctttctatgatt
ctgaacatcttcaacagctatggaaattcagatgcagcaaacggagatcttggtctgcat
cgtctgattgaagcattgaaacacatgtttgcaatccgaatgaacttgggtgatcctgct
tttgtagatacccatgaatatgcatctgatatgctttctccatcctttgctaaggaaatt
cagcagaagatatttgacaacacaactttcccactagagtactattcatacaggcatgat
cacccaacattttatagtctaaattag

KEGG   Rosa chinensis (China rose): 112188635Help
Entry
112188635         CDS       T06020                                 

Definition
(RefSeq) glutathione hydrolase 1-like isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00430  Taurine and hypotaurine metabolism
rcn00460  Cyanoamino acid metabolism
rcn00480  Glutathione metabolism
rcn00590  Arachidonic acid metabolism
rcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112188635
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    112188635
   00460 Cyanoamino acid metabolism
    112188635
   00480 Glutathione metabolism
    112188635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rcn01002]
    112188635
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rcn04090]
    112188635
Enzymes [BR:rcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     112188635
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     112188635
    3.4.19.14  leukotriene-C4 hydrolase
     112188635
Peptidases and inhibitors [BR:rcn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   112188635
CD molecules [BR:rcn04090]
 Proteins
  112188635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 112188635
NCBI-ProteinID: XP_024183556
Position
2
AA seq 579 aa AA seqDB search
MSYMVPILLTVVLLFLSLLPSTTSLHAASGLTQNRREVIIARNGAVATDDGRCSKIGMTV
LREGGHAVDASVAAALCLGVVSPASSGIGGGAFMLIRQGNGKAQAFDMRETAPALASQNM
YAANATLKSKGALSVAIPGELAGLHEAWKQHGRLPWERLVKPAERLARLGFKISPYLNMQ
MTITESGILADEGLRHIFTSKGRLLQTGVTCRNRKLAETLRQISKFGPVAFYNGSIGSKF
IRDIRKAGGILTMNDLQSYKVKVTKPVSIDTLGHKILAMPPPSGGPLLILMLNILSKYGN
ISGVSDPLWVHRQIESLKHVFAVRMNLGDPDFVNVTKVLADMLSPKFAEELKKTILDNMT
FDPSHYGGRWGQINDHGTSHLSIIDHEQNAISMTTTVNSYFGAQMLSSSTGIVLNNEMDD
FSIPGNVSTVPPPAPANFIRPGKRPLSSMTPTIILKDEQLKAVVGASGGAMIIPATAEVL
LNHFARGMDPLSSVLAPRFYHQLYPNVVHYENWTTVIGDHFELPAQIRKSLQKKGHVLEP
LAGGAICQFIVIEVLKKNGGSQEFVAVSDPRKGGIPAGF
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatatggtgccgattttgcttaccgttgtacttctgtttctctcactgttacct
tctactacgagcctccacgctgcaagtggtttaacccaaaacaggagagaggtaattatt
gctcgaaatggtgctgttgcaactgatgatggccgatgttccaaaattgggatgactgtt
cttcgagaaggaggtcatgctgttgatgcatctgtagctgccgctctgtgcttaggggtg
gtgagtccggcatcaagtggcattggtggaggagccttcatgcttattaggcaaggcaat
gggaaggcacaagcctttgatatgagagaaactgccccagcgctggcttctcagaacatg
tatgctgccaatgctactttgaaaagtaaaggcgctctctctgtagcgattccaggggaa
cttgcaggccttcatgaagcttggaaacaacatggaaggcttccatgggaaaggcttgta
aagcctgctgagcgcctcgctcgtttgggatttaagatttcaccatacctcaacatgcaa
atgactataacagaatcaggaattttggcagatgagggccttcgtcatatatttacatca
aaagggaggctcttacagacaggtgtaacatgccgtaacaggaaactcgcagagacactc
agacaaatctcaaagtttggtcccgtagccttctataatggttccattggatccaaattc
attagagatattcgaaaggctggaggaatacttacaatgaatgatttgcaaagttataaa
gttaaagtgacaaagccagtatctattgacactctggggcataaaatactagctatgcct
cccccttctggaggtcctcttttgatacttatgctaaacattctttccaaatatggaaat
atttctggagtttccgatcctctttgggtccatcgacagattgagtccttgaagcatgta
tttgctgtgaggatgaatcttggtgaccctgactttgttaatgtgactaaagttctagct
gatatgctttctcctaaatttgccgaggagttaaagaaaaccatacttgacaacatgaca
tttgatcccagccattatggtggcaggtggggacagatcaatgatcatggcaccagtcat
ttgtccatcatagatcatgagcaaaatgccatctccatgaccactactgtgaattcatac
tttggtgcacaaatgctgtcatcaagtacaggaatagtcctaaacaatgaaatggatgat
ttctccatacctggaaatgtttcaacagttccaccaccagcgccagccaattttatcagg
ccgggaaaaagaccattgtcatcaatgacacctaccataatcctgaaggatgagcaactt
aaagcagttgtaggtgcaagtggaggagccatgatcattcctgcaacagcagaggtcctc
ttaaatcattttgcaaggggaatggatccactctcttctgtcctggctccacggttttat
catcagctgtatcctaatgtggtgcactatgagaactggacaaccgtgataggtgatcac
ttcgaacttcctgctcaaatcaggaaatccctacaaaagaaaggccatgtccttgagcct
cttgctggtggagctatttgccagtttatagttatagaagttttgaagaaaaatggaggt
agtcaagagtttgtggccgtgagtgatccaagaaaaggagggattcctgctggtttctag

KEGG   Rosa chinensis (China rose): 112189285Help
Entry
112189285         CDS       T06020                                 

Definition
(RefSeq) glutathione hydrolase 3
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00430  Taurine and hypotaurine metabolism
rcn00460  Cyanoamino acid metabolism
rcn00480  Glutathione metabolism
rcn00590  Arachidonic acid metabolism
rcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112189285
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    112189285
   00460 Cyanoamino acid metabolism
    112189285
   00480 Glutathione metabolism
    112189285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rcn01002]
    112189285
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rcn04090]
    112189285
Enzymes [BR:rcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     112189285
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     112189285
    3.4.19.14  leukotriene-C4 hydrolase
     112189285
Peptidases and inhibitors [BR:rcn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   112189285
CD molecules [BR:rcn04090]
 Proteins
  112189285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 112189285
NCBI-ProteinID: XP_024184357
Position
2
AA seq 625 aa AA seqDB search
MGQQSLATPLVSDNNNKSWNRNARALWILLAFTAIIFVGLIFGGNGNTNGWVVLRESDKG
IGANESDIVESEHGVVAADDARCSKIGASILRQGGHAVDASVATALCLGVVNPMSSGIGG
GGFMVVRSSATSKTQAFDMRETAPSAASQNMYESNAEAKLYGALSMGVPGEIAGLHEAWL
QHGRMAWRTLFQPAIKLAKEGFEVAPCLGGHIRSCEEMIIKDPGLRQVFAPNGKVLKAGD
KCYNVELGNSLEAIAELGPQAFYNGSLGEKIVKDVREAGGILTMEDLRNYKVNVTDAMTA
NVLGYTISGMPPPSAGTLGLSMILNIFNSYGNSDAANGDLGLHRLIEALKHMFAIRMNLG
DPAFVDTHEYASDMLSPSFAKEIQQKIFDNTTFPPEYYSYRWSQLRDHGTSHFCIVDADR
NAVSMTTTVNYPFGGGVLSPSTGIVLNNEMGDFSIPTDISPDHLPPAPSNFIEPIKRPLS
SMTPIIVTKDNQLVGALGGSGGLNIIPAVTQVFINYFILGMEPLAAVQSPRVYHRLIPNI
VSYENWTVIDGDHIELSDERKLFLQERGHELQAKAGGAITQLIVQRLGNPIQMGRKCGRS
SNENVFHGILTAVSDPRKDGRPAAV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagcagagcttggcaactccacttgtgtctgataacaacaacaagagctggaac
aggaatgctagagcgctgtggattctgcttgcttttacagcaatcatttttgtggggctt
atttttggtggcaacggcaacacaaatggctgggtagtactgagagaatcagataagggg
attggagcaaatgaatctgacattgttgagtcagagcacggtgttgttgctgctgatgat
gccaggtgttccaaaatcggtgcatcgattcttaggcagggtgggcatgctgttgatgct
tcagtggcaacagcattgtgccttggcgttgttaatccgatgtcaagtggaataggaggt
ggggggtttatggttgtcagatcttcagcaacctcgaaaacccaagctttcgatatgagg
gaaactgctccttcagctgcttcacagaatatgtatgaaagcaatgctgaagccaagtta
tatggtgcattgtcaatgggggttcctggtgagattgctggtctacatgaagcatggtta
caacatgggcgaatggcgtggaggactttatttcagcctgcaataaagctcgctaaagag
ggatttgaagttgctccttgtcttggaggacatatacgttcatgtgaagaaatgattata
aaagaccctggcttaaggcaagtgtttgccccaaacgggaaggtgttaaaagcaggtgat
aagtgttataatgtggaacttggcaatagcttagaggcaattgcagaactggggccacaa
gccttctacaacggtagtcttggtgaaaaaattgtaaaagatgtgagagaggctggtggg
attttgacaatggaggatttgaggaattacaaagtgaatgttacggatgccatgactgca
aatgtgttgggatatactatatcaggaatgccacctccttcagctggaactttggggctt
tctatgattctgaacatcttcaacagctacggaaattcagatgcagcaaacggagatctt
ggtctgcatcgtctgattgaagcattgaaacacatgtttgcaatccgaatgaacttgggt
gatcctgcttttgtagatacccatgaatatgcatctgacatgctttctccatcctttgct
aaggaaattcagcagaagatatttgacaacacaactttcccaccagagtactattcatac
aggtggagtcagctcagagatcacggaacaagtcatttctgcatagtagatgcagataga
aatgcggtatcaatgacaaccactgtaaactatccttttggaggtggagtactctctcct
tctactggaattgtgctcaacaatgagatgggtgacttctcaattcccactgacatatcg
ccagaccatctccctcctgctccgtcaaatttcattgaaccaatcaaaagacctttatct
tccatgactcctataatagtcacaaaggataatcaattggttggtgcgcttggaggtagt
ggtggtttgaacattatcccagctgtaactcaagtgtttatcaattatttcatattgggg
atggaacctttagccgcagttcaaagtccaagggtctaccacaggctaataccaaacata
gtgtcctatgaaaactggactgtaatcgatggagatcatatcgagctttcagacgaaaga
aagctcttcttgcaggagcggggtcatgaattgcaggctaaagccgggggagccatcact
cagctcattgttcaaagacttggaaaccctattcagatgggcaggaaatgtggtagaagt
tcaaatgaaaacgttttccatggtatactcacagctgtaagtgaccccagaaaagatgga
aggcctgcagctgtatga

DBGET integrated database retrieval system