KEGG   Rosa chinensis (China rose): 112169443Help
Entry
112169443         CDS       T06020                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn03040  Spliceosome
rcn04141  Protein processing in endoplasmic reticulum
rcn04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112169443
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112169443
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112169443
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rcn01009]
    112169443
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcn03041]
    112169443
   03009 Ribosome biogenesis [BR:rcn03009]
    112169443
   03110 Chaperones and folding catalysts [BR:rcn03110]
    112169443
   04131 Membrane trafficking [BR:rcn04131]
    112169443
   03051 Proteasome [BR:rcn03051]
    112169443
   03029 Mitochondrial biogenesis [BR:rcn03029]
    112169443
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcn04147]
    112169443
Protein phosphatases and associated proteins [BR:rcn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112169443
Spliceosome [BR:rcn03041]
 Complex B
  Other components
   Prp19 complex
    112169443
 Complex C
   Prp19-CDC5 complex
    112169443
Ribosome biogenesis [BR:rcn03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112169443
Chaperones and folding catalysts [BR:rcn03110]
 Heat shock proteins
  HSP70 / DNAK
   112169443
Membrane trafficking [BR:rcn04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112169443
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112169443
Proteasome [BR:rcn03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112169443
Mitochondrial biogenesis [BR:rcn03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112169443
Exosome [BR:rcn04147]
 Exosomal proteins
  Proteins found in most exosomes
   112169443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Actin FGGY_C
Motif
Other DBs
NCBI-GeneID: 112169443
NCBI-ProteinID: XP_024162232
Position
6
AA seq 626 aa AA seqDB search
MNPINTVFDAKRLIGRRFSDSCVRSDMKLWPFKVISGDNNKPMIVVKYKNETKQLAPEEI
SSMVLYKMREIAEAYLGSVVKTAVVTVPAYFNDSQRLATKDAGLIAGMNVMRIINEPTAA
AIAYGLDKKVSSTGGKNVLIFDLGGGTFDVSILKIEDEIFEVKATTGDTHLGGEDFDNRM
VNHFVQEFEKKHKKDISKNPKALRRLRTSCERAKRTLSSTTETTIEIDSIFEGKDFFSKI
TRAKFEELNMDLFLKCMESVENCMRDAEIDNSIIHDIVLVGGSTRIPKLQQLLQDFFNGK
ELCKNINPDEAVAYGAAVQAAVLSGGVEKVQDLLLLDVTPLSLGVRRYTGKTTVMIPRNT
TIPTKKERVFTTIMQNQSGIIIDVVEGERIMARDNKLLGGMVLSGLPPSPKGVPSISVCY
EIDANGILVISAEEILLTGRKKKITINDYKNRLHSWEIEKMVKEAEKYKAEDEENKKKEE
AKVLFELYAYGLRDSVNDLALNEANKKTIVDAVKKALLWLNANQLVECSKYDDERAKLES
LCNPIIAKAKMRQNAGSKSQGLEEEMPPAHRGRGNSSSPISFRFQFHLLIYAFTISNNWT
ELQRFNQKIQFLGLSNCLGIDWKFSC
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccattaatactgtttttgatgcaaagcgtttgattggtaggagatttagtgat
tcatgtgttagaagtgacatgaagttatggcctttcaaggtgatttctggcgataataac
aaaccgatgattgtagtcaagtataagaatgaaacaaaacaattagctccggaagagata
tcatcaatggttctctataagatgcgtgaaatagcagaggcctatcttggatcggtagta
aagactgcagttgtaactgtcccagcatattttaatgactctcaacgactggccacaaag
gacgctggtttaattgccggaatgaacgttatgcgtatcatcaatgagccaacagctgcg
gcaattgcttatggtcttgacaaaaaagtcagtagcactggtgggaagaatgttctcata
ttcgatcttggtggtggtacctttgatgtctccattcttaaaattgaagatgagattttt
gaagtgaaagctacgactggagatactcatcttggaggtgaagattttgacaatagaatg
gtgaaccattttgtacaagagttcgagaagaaacacaagaaggacattagcaaaaaccct
aaagcattgaggagattgagaacatcttgtgagagagcgaaaaggactctttcttcaact
actgaaaccactattgaaattgattctatatttgagggtaaagactttttctccaaaata
acgagagcaaaatttgaggagctcaatatggatctctttttaaaatgtatggagtctgtg
gagaattgtatgagggatgctgaaatagacaatagcatcattcatgatattgttcttgtc
ggtggatctactagaattcccaagctacaacagctattgcaggatttttttaatggtaag
gagctttgcaaaaatatcaatccagatgaagcagttgcatatggcgctgccgtacaggct
gcagttttgagcggtggcgttgagaaggttcaggatttactcttgctggatgtgactcca
ctttcccttggtgtgcggcgttatacagggaaaacaactgttatgatcccaagaaacact
actattcccaccaagaaagaaagagttttcacaaccatcatgcaaaaccaatctggtata
attatagatgttgttgagggtgaaagaataatggcccgagataacaaattgttgggtgga
atggtactctccggcttacctcctagtccaaaaggtgtaccttcgatcagtgtttgctac
gagatagatgcgaatggaattttggttatctctgcagaggagatattattaacaggaagg
aagaaaaagatcacaatcaatgattacaaaaataggttacatagttgggaaatagaaaag
atggtaaaggaggcagagaagtacaaggcagaggatgaggagaataaaaagaaagaagag
gctaaggttttatttgaattatatgcatatggcttgagggatagcgttaatgatcttgcc
cttaatgaggcaaacaagaagacaattgttgatgcagttaaaaaggctttgctgtggctt
aatgcgaaccaacttgtggaatgcagtaaatacgacgatgaaagggcaaagcttgagagt
ctctgcaatcccatcattgcaaaagccaagatgcgtcagaatgctggtagcaaaagtcaa
ggtcttgaagaagaaatgcctccagcgcatcgcggtcgcgggaactcgagcagtcctatt
tcttttcgatttcaatttcatctccttatttatgcttttacgatttcaaacaattggact
gaattgcaaagatttaatcaaaagattcaatttttgggattatccaactgtttggggatt
gattggaaattctcgtgttag

DBGET integrated database retrieval system