KEGG   Rosa chinensis (China rose): 112169479Help
Entry
112169479         CDS       T06020                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: disease resistance-like protein DSC1
Organism
rcn  Rosa chinensis (China rose)
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 TIR MreB_Mbl NB-ARC TIR_2 LRR_8 FGGY_C LRR_4 LRR_3 AAA_22 AAA_16 NACHT AAA AAA_14 AAA_18 ATPase_2
Motif
Other DBs
NCBI-GeneID: 112169479
NCBI-ProteinID: XP_024162279
Position
6
AA seq 2238 aa AA seqDB search
MESTPSRRRRKYDVFLSFRGPDTRKGITSELYQRLERRGIETFMDDPDLQVGDSISPKLL
AAIEESRFAVVILSPNYASSPWCLEELVKIIQCMKETGLRVMPVFYNVEPCEVRHQMGSF
ELKRKPRPQVDVEVREYEEAYGKTEDTLKAWRAALTEVANLSGWDSKKFSTDRELVEAIV
WKIESKVVYKSSSVDKGFVGMDSRLDDLLREYIYPELDEVRIIGIHGMXGVGKTTLARAF
YDDCCQDFEHRCFLPNVRERFKGGGLVSLQKKLLSSILMDKIEYIEDEYTGAAMIQRSLC
KTKVLVVIDDVDQLAQLEKLAGSRDWFGPGSRIIITTTDIHLLEAYDVDAIYEATTLNFG
EALQLLSFKAFKKSSPPENYSDLCIDILEYAQGLPLALVVIGSFLCGRSTNEWASASDRL
KNAPNREIIDVLQISFDGLEDIEKEIFLHIACLYKGKDWDRVRQILDYCKLNPVIGLRVL
ADKSLITTSHNEVSMHDLLQEMGREIVRRESPKEPGKRSRLWSREEIHNVLKKNKGTEAI
QGMVMEWSELEVAHWNPEALSNLSQLILLHIHNVDLPKGLTCLPNSLRLLEWPGCPLRSL
PRTFEPDELIELNLCHSNIEHLWKGTKNFNKLKFIKLCHSQNIVEIPDLAGVQNLESLEL
EGCKSLVRIHQSLGCLKKLIVLNLKDCKSLENLPGRIEMESLEKLILSNCSKIKKIPEFD
GNMERLSVLHLDGTAIEGLPVSIGRLSGLVSLNLSKCRNLVCLPSTIVHLCKVVWGSLNK
FLPSGLQKVNGEPMSFSLPRLCNLTDLNLSNCNLGEGAFANEFSYFPSLVTLNLSGNNFV
RLPSGIGSLSKLEYCKLKNCKRLEDLSDLPLNSNLILKADGCTSLKYLFDASNFNRLDES
CFGSGFNFMNCVNLKGNQGCNSMAFEMLKAVMYQGLSSETKTIRIVIPGSNIPEWFSHRS
VGCSVCVELPPDWDSSRFMGFALCVVFVLHENHCLKRFKTFNDDHYLSCSMKLNGEEFAG
NIREPLFCFRDEVCPFELDHLWLLYVSRDGYFGSTGWWHNICGQLNFLFHTNELYPNGNK
CEVRLCGVRLIYEQDVQELNKQTTQSSRRMSPDEDRLIDLDIAVDGETSGTGICMSIEKE
EIQQRELDGLLEARAEAEANKASNNYYNGIVPFLLSHQWNSIYPFEISAEIKVPQVITTI
PIVRIRDIQPLLTDLLLKVRVSRVWRVKKHKPTPRNDGLQFVLVSEKMSFYGKLAKRAVE
TDMLVMVQARIHAGKLFTCVELIMALAAKGEGPAIGIDLGTTYSCVGVWQHDHVEIIAND
QGNRTTPSYVAFTNIGLLIGDAAKNQVTINPINTVFAAKRLIGRKFSDACVKSDMKLWPF
KVRGVGDKPMIVINYKNEKKQFAAEEISSMVLHKMREIAEAYLGLTIKNVVITVPAYFND
FQRQATKDAGVIAGMNVMRILNEPTAAAVAYGLDKKATTIGGKIVLIFDLGGGTFDVSLL
KIEDEIFEVKATAGDTHLGGEDFDNRMVNHFVQEFEKKHRKDISNDPKALRRLRTSCERA
KRTLSSTAETTIEIDSLFEGIDFHSKITRAKFEELNMDLFRKCMETVENCVSDAKIDRKI
VDDIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGSAVQAAVLHGVYGSSYHD
LVLVGAAKSEGPAIGIDLGTTYSCVGVWKHDRVEIIANDQGNRTTPSYVAFTNIGRLIGD
AAKNQVTINPINTVFGAKRLIGRKFSDACVKSDMKLWPFKVRGVGDKPMIVINYKNEKKQ
FAAEEISSMILSKMREIAEAYLGLTIKNVVITVPAYFNDSQRRATKDAGVIAGMNVMRIL
NEPTAAAIAYGLDKKAMTIGGKNVLIFDLGGGTFDVCILQIEDEIFEVKAIAGDTHLGGE
DFDSRMVNHFVQEFEKKHRKDISNDPKALRRLRTSCERAKRTLSSTAETTIEIDSLFEGI
DFHSKITRAKFEELNMDLFRKCTETVENCVRDAKIDRKIVDDIVLVGGSTRIPKVQQLLQ
DFFNGKELCKSINPDEAVAYGAAVQAAVLHGGVEKVQDLLLLDVTPLSLGRMRQTGEFDV
FVPRNTTIPTKKTKVATTVLQNQTGLIVDVYEGEETRAEKNKLLGQFVLRGIPPGPKGKP
QFTICFEIDANGILIVSAEEKELCLENKIIISNYRDRGGLSNVEIAKVIKEAEKYKVIVX
DQEFNEKVKAKSALGDCT
NT seq 6717 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaaccccttctcgtcgtcgacggaagtacgatgtgtttttaagtttcagaggg
ccagatacgcgaaaggggattacctccgagctgtatcagagactagaacggagaggaatt
gaaacctttatggatgacccggatcttcaggtaggagattccattagccctaaacttttg
gctgcaattgaggagtcaagatttgccgttgttattctttcacccaactacgcttcttcg
ccatggtgcttggaagaactcgtcaagattattcagtgcatgaaagagacagggctacga
gtcatgcccgtgttctacaacgtggagccttgcgaagtgcggcaccaaatgggaagtttt
gagctcaaaaggaaaccccgaccccaagtggacgtggaagtaagggaatatgaagaagct
tatggcaagactgaggatacattaaaggcgtggagagctgctttgacagaggtagccaat
ctttctgggtgggattcaaagaagtttagtactgatagagaacttgttgaggcaattgtt
tggaaaattgagagtaaggtggtgtataaatcttcaagtgttgacaagggcttcgtagga
atggattcccgtcttgatgatttattacgtgagtacatatatccagagttggatgaggta
cgtattatagggatacatggcatgtgaggagtaggtaagacaacgcttgctcgagctttt
tatgatgactgttgtcaggattttgagcatagatgctttcttcccaatgttagagaaagg
tttaaagggggtggcctagtttctttacaaaagaagcttctttccagcatcttgatggac
aaaattgaatacatagaggatgaatatacaggagctgctatgattcaaagaagtttatgc
aaaacaaaggtgcttgttgttattgatgatgtggatcagttggcacaattagaaaaattg
gctggaagtcgagactggtttggtccagggagcagaattatcataaccaccaccgatatt
cacttgttagaggcatatgatgttgatgctatatacgaggctaccacgttaaattttggt
gaggctcttcaactcttgagttttaaggctttcaagaaaagctccccaccagaaaattat
tcggacctgtgcatcgatattttagagtatgctcaggggctgccgttagctcttgtggtt
ataggttcttttctatgtggtagaagcaccaatgaatgggctagtgcaagtgatcgacta
aaaaatgcaccaaatagagaaattattgatgtgcttcagattagttttgatggtctagag
gacatagagaaagaaatattcctacatattgcttgtctttacaaggggaaagattgggat
cgtgtgagacaaatactagactattgtaagctgaaccctgtcattggattaagagttctt
gctgataaatctctcattactacttcgcacaacgaagtgtcaatgcatgatttgctacaa
gaaatgggccgggaaatagttcgtcgagagtctccgaaagagccaggcaaacgtagtaga
ttatggtctcgtgaagaaatccacaatgtgctgaagaaaaataagggaacagaagcaatc
caaggcatggtaatggagtggtctgaattagaagtggctcattggaatccagaagccttg
tcaaatttgtctcaacttattcttctccatattcataatgtggaccttcctaaaggcctt
acctgtcttcctaattccttgagactcctggaatggcctggctgtccgttaagatctctc
ccacgaacgttcgaaccagatgaacttattgaacttaacttgtgtcacagcaatattgaa
catctttggaagggaacaaagaattttaacaagttgaagttcatcaaactctgccattct
caaaacattgtggagatcccagaccttgcaggtgttcagaatcttgagagtttagagctc
gaaggatgtaagagtttggtaagaatccatcaatcccttggatgtctcaaaaagcttatt
gtcctgaatctcaaagactgcaaaagtcttgagaatctgccaggtagaattgaaatggaa
tctcttgaaaaattaattctttctaactgctccaaaattaaaaagattcccgagtttgat
ggaaatatggagcgtctgtctgtgcttcatcttgacgggactgccattgagggactgcct
gtttcaattggacgcctgagtggccttgtgtcattgaatctaagtaagtgcagaaatctt
gtttgtcttccaagcaccattgttcatttatgcaaagtagtttggggatctttaaataag
ttcttgccttctggattgcaaaaagtgaatggagagccaatgagtttcagcttgcctagg
ctgtgtaatttaacagatctgaacctgagtaattgcaatcttggtgaaggagcatttgcc
aatgaattcagttactttccctctttggtgaccttgaatctaagtggaaacaattttgtt
cgtcttccttcaggcattgggtcgctttccaagcttgagtactgtaagttgaagaattgc
aagagacttgaagatctgtcagaccttccattgaatagtaacctaattttaaaggcagat
ggttgtacttcactgaaatacttgtttgatgcatcaaattttaacagattagacgaatca
tgttttggttcaggtttcaatttcatgaattgcgtcaatctaaagggcaatcaaggatgc
aatagcatggcatttgaaatgctgaaggcagtcatgtatcagggactctctagtgagacg
aaaactattcgaattgtaattcctggaagtaatattcctgagtggttcagccatcgaagt
gttgggtgttcagtatgtgtagagctgcctccagattgggatagcagtaggtttatggga
tttgctttgtgtgttgtttttgtactccatgagaaccattgtcttaagcgattcaagact
tttaacgatgatcattatctttcctgtagcatgaagctcaatggagaagaattcgctgga
aatatccgagagcctttattttgctttcgtgatgaagtttgcccgtttgagttggatcac
ctgtggctattgtatgtatctcgtgatggatactttggtagtacagggtggtggcataac
atttgtggtcagcttaatttcttatttcataccaatgagctgtatccgaatgggaataag
tgtgaagtccgtctgtgtggagtccgtctgatatatgagcaagacgtgcaagagttgaac
aaacaaacaactcaatcaagcaggaggatgtctccagatgaggatagattgattgattta
gacattgcagttgatggggaaactagtggcactggtatttgtatgtctatagaaaaagaa
gaaatccagcagagggagcttgacggattgcttgaagcaagagcagaagcagaagcaaat
aaggctagcaataactactacaatggcatagtaccttttctgctatcacatcagtggaat
tcaatatacccatttgagattagtgcagaaatcaaagttccgcaagtgataaccacaatc
ccaatcgtccgaatacgagatatccaacctttactgactgacctactactcaaagtgcgt
gtctccagggtgtggagagtgaagaaacataaacctactcctagaaatgatggtcttcag
tttgtcttagtgagtgagaagatgagtttctatggaaagcttgcaaagagggcagtggag
actgatatgctggtcatggttcaggcacgtattcacgccggcaagctctttacctgcgtt
gaattaataatggcattagcggcgaaaggcgagggtccagctatcggcatcgatctcgga
acaacttattcatgcgttggagtttggcaacacgatcacgttgagatcatagccaatgat
cagggcaacagaacgacaccatcgtatgttgcttttaccaatattggccttttgatcggt
gatgctgccaagaaccaagtcaccatcaaccctatcaacactgtttttgctgcaaagaga
ttgattggcaggaaatttagtgatgcatgtgttaagagtgatatgaaattatggcctttc
aaggttcgtggtgtgggtgacaagcctatgattgtgatcaactacaagaatgaaaagaaa
caatttgccgctgaggagatatcttcaatggttctccataagatgcgcgaaattgcagag
gcctatcttggactaacaataaagaatgttgttataactgtaccagcatacttcaatgac
tttcaacgacaggctacaaaagatgctggggtgattgcaggcatgaatgtgatgcgtatt
cttaatgagccaacagccgcagctgttgcatatggtcttgacaaaaaggccacgactatc
ggtggtaaaattgttctcattttcgatcttggtggtggtacttttgatgtttcccttctt
aaaattgaagatgagatttttgaggtaaaagctactgccggagatacacatcttgggggt
gaagattttgacaatagaatggtgaaccattttgtgcaagagttcgagaagaaacacagg
aaggacatcagcaatgaccccaaagcactgagaagattgagaacatcttgtgagagagca
aaaaggactctttcttcaactgctgaaaccaccattgagattgattctttattcgagggt
atcgacttccactccaaaataacgagagcaaaatttgaagagctcaacatggatctcttt
agaaaatgtatggagactgtggagaattgtgtgagtgatgctaaaattgataggaaaatt
gttgatgatattgttcttgttggtggatctactagaattcccaaggtacaacagctattg
caagatttctttaacggtaaggagctttgcaagagcatcaatcctgacgaagcagttgca
tacggttctgccgtacaggctgcagttttgcatggtgtatacggatcatcatatcacgac
ctcgttttggtgggcgcggcgaaaagcgagggtccagctattggcatcgatctcggaaca
acttattcatgcgttggcgtttggaaacacgatcgcgttgagatcatagccaatgatcag
ggcaacagaacgacaccatcatatgttgcttttaccaatattggccgtttaatcggtgat
gctgccaagaaccaagtcaccatcaacccaatcaacactgtttttggtgcaaagcgattg
attggcaggaaatttagtgatgcatgtgttaagagtgatatgaaattatggcctttcaag
gttcgaggggtgggtgacaagcctatgattgtgatcaactacaagaatgaaaagaagcaa
tttgctgctgaggagatatcttcaatgattctcagtaagatgcgcgaaattgcagaggcc
taccttggactaacaataaaaaatgttgttataactgtaccagcatacttcaatgactct
cagcgacgggctacaaaagatgctggggtgattgcaggcatgaatgtgatgcgtattctt
aatgagccaacagcagcagctattgcatatggtcttgacaaaaaggccatgactattggt
ggtaaaaatgttctcattttcgatcttggtggtggtacttttgatgtttgcattcttcaa
attgaagatgagatttttgaggtaaaagctattgccggagatacacatcttgggggtgaa
gattttgacagtagaatggtgaaccattttgtgcaagagttcgagaagaaacacaggaag
gacatcagcaatgaccccaaagcactgagaagattgagaacatcctgtgagagagcaaaa
aggactctttcttcaactgctgaaaccaccattgagattgattctttattcgagggtatc
gacttccactctaaaataacaagagcaaaatttgaagagctcaacatggatctctttaga
aaatgtacagagactgtggagaattgtgtgagggatgctaaaatcgataggaaaattgtt
gatgatattgttcttgttggtggatctactagaattcccaaggtacaacagctattgcaa
gatttctttaatggtaaggagctttgcaagagcatcaatcctgacgaagcagttgcatat
ggtgctgccgtacaagctgcagttttgcatggtggcgttgagaaagtgcaggacttactc
ttgttagatgtaactccactttcccttggtcgtatgcgtcaaacaggagagtttgatgtt
tttgtcccgagaaacaccaccattcccaccaagaaaactaaggttgccacaactgtctta
caaaaccaaaccggtttgatagttgatgtgtatgagggcgaagaaacaagagccgagaaa
aacaaattgttgggtcaatttgtgctaagaggaatccctcctggtccaaaaggaaaacct
caattcacaatttgcttcgagattgatgccaatggaattttgattgtctccgctgaggaa
aaagaactctgtcttgagaataagattataatctccaattatagggataggggcgggtta
tctaacgtggaaattgcgaaggtgatcaaggaagcagagaagtacaaggtgatcgtatag
gaccaggaatttaacgagaaagtgaaggctaagtctgcattgggagactgcacataa

DBGET integrated database retrieval system