KEGG   Rosa chinensis (China rose): 112173310Help
Entry
112173310         CDS       T06020                                 

Definition
(RefSeq) putative receptor protein kinase ZmPK1
Organism
rcn  Rosa chinensis (China rose)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin S_locus_glycop PIP49_C PAN_2 APH YukC
Motif
Other DBs
NCBI-GeneID: 112173310
NCBI-ProteinID: XP_024166691
Position
6
AA seq 799 aa AA seqDB search
MASLFHIFLLFLAIYSQISSSTSDTLNKGSSLSVEKPDDVLTSPDGVFTAGFHQVGNNSF
CFAIWYSEPFDHYKYRTIVWMANRDQPVNGKHSKLSLLKTGDLILTDAGQSNVWSTATTS
VSPANLSLHNSGNLVLLNSEHVILWQSFDYPTDTLLSSQPLTRSTILVSMRSPSNYSSGF
YKLFFDNDNLLRLLFDGLEVSSVYWFEPWLTGRDAGRSTDNSSRVAVMDSLGKFTSSDTY
TLIASDYGAAWQRRLTVDCDGNVRLHSRAKPGDRWIVTGQIIQDPCKIHGVCGPNSVCSY
EPGTGRKCSCIPGYKMSNLTDWYYGCEPEFNYTCGRGESSFFKLSKLEFFGYDYGYFTNY
TFMECQDLCLQLCNCKGFQYSRIPSLSIYSCYPKTVLLNGYRSPSFFGDIYLRVPKIHLS
SYGLPQQDYSLSCLDKVVELDRTYEKSRVTGLVKFLLWFACGVGGFEIICILLVLGLITR
NRRDSTEDKYGYHLAATGFKRFSYAELKKATRGFSEEIGRGAGGVVYKAVLADHRVAAIK
RLNETNQGEGEFSAEVNTIGRLNHMHLIEMWGYCSEGKHRLLVYEYMEHGSLAQKLASNV
LDWEKRFEIALGTAKGLAYLHEECLEWVLHCDVKPQNILLDSNYQPKVADFGLSKLLDRD
DLKNWSFSRIRGTRGYIAPEWVYNLPITSKVDVYSYGVVVLEMVTGKNPIKPDVDAIDGE
QRRLIMWVREKLHNGTSASEIEARIGDVIDPSFEGKYDVKKMGILLGVALHCVEEDRDAR
PTMSQVVEMLVPLDKDQEH
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctgtttcacatttttcttctttttcttgcaatttattcccaaatctcgtct
tcaacctccgacactctgaataaaggctcatccctatctgtagagaaaccagacgatgtt
ttaacttcaccggatggagttttcaccgccgggtttcaccaagtcggcaacaattcattt
tgctttgctatttggtacagtgagccatttgaccactacaaatacagaaccatagtctgg
atggccaaccgtgaccagccagtcaatggcaaacactcaaagctctccctcctcaaaact
ggtgatctcatcttaaccgacgctggtcaatccaatgtttggtccacagccaccacttca
gtctctccggcgaacttaagcctccacaattccggcaatcttgttttgctcaactcggag
catgtcattctatggcagagctttgattaccctactgatactcttctttcgagccaacca
ctcaccagaagcacaatccttgtctccatgagaagcccgagcaactactcctcaggcttc
tacaagctcttctttgacaatgacaaccttctccggctactcttcgacggtcttgaggtt
tcaagtgtgtattggtttgagccgtggctcacaggccgagacgccggaaggtccacagat
aacagcagtagagttgccgtgatggattccctaggcaagtttacttcatcggacacctat
actttgatcgcttccgattatggtgcagcttggcagagaagactgacggttgattgtgat
ggaaatgttcggttgcacagccgggccaaacccggagacagatggattgtgacagggcag
atcattcaagatccttgtaagattcatggggtttgtggtcctaatagtgtgtgcagctat
gagcctggcaccggaagaaaatgttcttgcattcctggttacaaaatgtcaaatcttact
gattggtattatggttgtgaacctgagttcaattacacttgcggtagaggtgagtctagt
ttcttcaagctctcgaagctcgagtttttcgggtacgattacggatacttcaccaactac
acctttatggagtgtcaggatctttgtttgcagctgtgtaactgcaaagggttccaatac
tctcgaatcccaagccttagtatatatagctgttatccgaaaacagtgttgctcaatggt
tacaggtctcctagctttttcggagacatatatttgagagtgccaaagatacatctgtca
tcttatggattgccacaacaagattatagtttgagttgcttagataaggtggttgagcta
gacagaacctacgagaagagccgtgtaactggtctagtgaaatttttgctatggtttgcc
tgtggagttggagggttcgagatcatttgtatacttttggttttgggtctaataactcga
aaccggagagattccactgaggataagtacggttaccatcttgctgcaactggattcaag
aggtttagctacgctgagcttaagaaggcgacgcggggttttagtgaagaaattggaaga
ggagcaggaggtgttgtttacaaagctgtgttggctgatcatcgagttgcagcgatcaag
aggcttaatgaaaccaaccaaggagaaggtgagttttcagcagaagtcaacactattggg
aggctgaaccatatgcatttgattgagatgtggggatattgctcggagggaaagcacagg
cttcttgtttatgagtacatggagcatggttccttggcacaaaagttagcttccaatgtc
cttgattgggaaaagaggtttgagattgctctaggcactgcaaagggtcttgcttatttg
catgaagaatgtttggagtgggttttacattgtgatgtgaagcctcaaaacatactcttg
gactccaattatcaaccaaaggttgcagattttggcctatccaagctcctcgacagagat
gaccttaagaactggagcttttcgaggatacgaggaactagaggttacattgctccggag
tgggtttacaatttgcctatcacatccaaagtggatgtgtacagctatggggttgtggtg
ttggagatggtgaccggaaagaacccgattaagccggatgtggatgccattgatggtgag
cagagaaggctgatcatgtgggtgagggagaaattacataatggaacttctgctagtgaa
attgaagctcggataggagacgtcatagacccttcgtttgaaggtaaatatgatgtaaaa
aagatggggattctgttgggagtggctttacattgcgtagaggaagacagagacgcgaga
ccaactatgagccaagtcgttgagatgcttgtgccgcttgacaaagaccaagaacattag

DBGET integrated database retrieval system