KEGG   Rosa chinensis (China rose): 112174496Help
Entry
112174496         CDS       T06020                                 

Definition
(RefSeq) alcohol dehydrogenase-like 7 isoform X1
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00010  Glycolysis / Gluconeogenesis
rcn00071  Fatty acid degradation
rcn00350  Tyrosine metabolism
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
rcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112174496
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112174496
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    112174496
Enzymes [BR:rcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     112174496
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     112174496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C UDPG_MGDP_dh_N Reo_sigma1
Motif
Other DBs
NCBI-GeneID: 112174496
NCBI-ProteinID: XP_024168038
Position
6
AA seq 392 aa AA seqDB search
MAAMDEKLSSGNRGKPIRCRAAVSRKPGEPLVMEEIMVAPPMPHEVRVRIVYTSLCHSDI
TFWKMKDFPGVFPRILGHEAIGVVESVGEDVTEVAEGDTVIPTLISDCGECVDCRSTKSN
LCSKLPFKISPFMPRHETSRFTDLNGEVIHHFVSVSSFSEYTVVDIAHLTKIDSAIPLTK
AAGLLGCGVSTGVGAAWRTANVEPGSTVAIFGLGSIGLAVAEGARLCGATRIIGVDVNQH
KFEIGKKFGVTDFINPANCENKSVTEVMIEMTDGGADYCFECVGIASLVQQAYACCRKGW
GKTIVLGVDQPGSQLTLPSYDVLHKGKTLMGSFFGGLKPKSDIPVLLNRYINKELQLDEF
VTHEVTFEDINKAFDLLTEGKCLRCVICMNNQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgccatggatgagaagttgtcaagtggaaacagagggaagcctattcgatgcaga
gctgcggtctctcgcaagccaggtgagccactagtgatggaagagatcatggtggcgccg
ccaatgccccatgaagttcgcgttcggattgtctatacttctctgtgtcacagtgatatc
actttttggaaaatgaaggactttcctggagtcttccctagaattctcggtcatgaagct
attggggttgtggagagtgttggggaggatgtgactgaggtagccgaaggagatactgtc
atccccacattgatttcggattgtggagaatgtgtagattgcagatcaacaaagagcaat
ctttgttcaaaacttcccttcaagatctcaccttttatgccaagacatgagacaagcaga
ttcacagacctcaatggcgaggttattcaccattttgtatctgtatctagttttagcgag
tatacagtggtggacatagcccatctcacaaagattgactctgcaatacctttaaccaag
gctgcaggccttctaggttgtggagtatcaacaggggttggtgctgcttggagaacagca
aatgtggagccgggatcaactgtggctatatttgggcttggttcaattggattggctgtg
gcagaaggtgcaagactatgtggagctactagaattatcggggtggatgttaaccaacac
aaatttgaaattggaaaaaagtttggagtcactgacttcatcaaccctgcaaattgtgag
aataaatctgttacagaggtgatgattgagatgactgacgggggtgcagattattgcttt
gaatgtgttggaattgcatcactggtgcaacaagcttatgcttgctgccggaagggttgg
ggaaaaacaattgtattgggtgtggaccagccagggtcacagttgacccttccctcatac
gatgtgcttcataagggtaaaaccctcatgggatccttctttggaggactcaaacctaag
tcggatatccctgtgctcctgaatcgctacatcaacaaggaactacaactagatgagttt
gtaacacatgaggtgacatttgaagacatcaacaaagcttttgatttgctcactgaaggg
aaatgtctccgttgtgtaatctgtatgaacaatcagtaa

DBGET integrated database retrieval system