KEGG   Rosa chinensis (China rose): 112175096Help
Entry
112175096         CDS       T06020                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00250  Alanine, aspartate and glutamate metabolism
rcn00410  beta-Alanine metabolism
rcn00430  Taurine and hypotaurine metabolism
rcn00650  Butanoate metabolism
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
Module
rcn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112175096
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112175096
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112175096
   00430 Taurine and hypotaurine metabolism
    112175096
Enzymes [BR:rcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112175096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 112175096
NCBI-ProteinID: XP_024168529
Position
7
AA seq 504 aa AA seqDB search
MVISTTAGDRADHFLDCTFASRYVRNPVPKFMMPATSQPKEAAYQIINDELMLDGAPRLN
LASFVTTWMEPECDKLMMASMNKNYVDMDEYPVTTELQNRCVNMIANLFNAPIGAAETAV
GVGTVGSSEAIMLAGLAFKRKWQHRRKLEGKPYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLIKKNKETGWET
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDE
LVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCMDNTRALKEGLE
KTGRFEILSKDIGVPLVAFKLKDSSKHTVFEIADSLRKFGWIVPAYTMPANAEHIAVLRV
VVREDFSRSLAERLLSDIDKVLNEIDTLPSRVSMKAAHVTPTVDEGVNASEGMVKPGKKS
VEEIQREVATYWRNLVERKRTGVC
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctcgacgaccgccggtgatcgtgcagatcactttctggactgtacctttgct
tccagatatgtgcgcaatcccgtccccaagttcatgatgccggcgacctcacaacccaaa
gaagcagcttatcagataataaacgatgagcttatgctggatggggctccaagactcaac
ttggcctcattcgtgaccacctggatggagccggaatgcgataaactcatgatggcctct
atgaacaaaaactatgttgacatggatgagtacccggtcaccactgaacttcagaatcgc
tgtgtgaatatgatcgccaaccttttcaatgctcccatcggagcagctgaaactgctgtt
ggcgtggggacggtaggatcttcagaggcaattatgctggctggcctagcttttaaaaga
aaatggcagcacaggaggaaattagaaggcaaaccctacgacaagcccaacattgtcact
ggagctaatgtgcaggtttgctgggaaaagtttgctaggtattttgaggttgaactgaag
gaggtaaagctatcagagggatactatgtgatggaccctgtcaaagcagttgagatggtt
gatgagaacactatctgtgttgcagctattctaggttcaaccctgacgggagagtttgag
gatgtgaagctccttaatgatcttcttattaagaagaataaggagacaggatgggaaact
cctattcatgttgatgctgccagtggaggctttatagcgccgttcctttatcctgaactt
gagtgggacttccgtttgccattagtcaagagtatcaatgtaagtggccacaagtatggc
cttgtatatgctggtgttggatgggttgtgtggaggagtaaagaggacttgcccgacgag
cttgtgtttcacatcaattatcttggatctgatcaaccaactttcaccctcaacttttcc
aaagggtctagccaaataattgctcagtattatcagtttatacgactgggatttgagggt
tacaaaaatgtaatggaaaactgcatggacaatacaagagcactgaaagaaggactagag
aaaacagggcggtttgaaattctgtccaaagacataggagtgcccctggtggctttcaaa
ctaaaagacagcagcaagcacactgtgtttgagatagctgatagtttgagaaagtttgga
tggatagttccagcctacactatgccagccaatgcagaacatattgctgttcttcgtgtg
gttgttagggaggattttagccggagcttggcggagagactcctctcagacatcgacaag
gttttgaacgaaatcgacacactgccaagccgcgtgtctatgaaagctgcacatgtgaca
cctactgtcgatgaaggagtcaatgccagtgaagggatggtaaagcctggtaagaaaagt
gtagaggaaattcaaagagaggtagcaacatattggaggaaccttgtggaaagaaagaga
acaggtgtatgctag

KEGG   Rosa chinensis (China rose): 112193489Help
Entry
112193489         CDS       T06020                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00250  Alanine, aspartate and glutamate metabolism
rcn00410  beta-Alanine metabolism
rcn00430  Taurine and hypotaurine metabolism
rcn00650  Butanoate metabolism
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
Module
rcn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112193489
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112193489
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112193489
   00430 Taurine and hypotaurine metabolism
    112193489
Enzymes [BR:rcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112193489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 112193489
NCBI-ProteinID: XP_024189429
Position
3
AA seq 501 aa AA seqDB search
MVLSKTASQSDVSVHSTFASRYVRTSLPRFRMGENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRRWQNKRRAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDDYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNQETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMENCRENMIVLREGLEK
TGRFKIVSKDEGVPLVAFSLKDNHCHDEFEISDLLRRYGWIVPAYTMPADAQHVTVLRVV
IREDFSHTLAERLVNDIQKVLHELDHLPSKLSSNSSIESQSVENNEKSTVTTKKSALETQ
REITTIWRKFVMEKKKITGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccaaaaccgcatcgcagtcagatgtctctgtccactccaccttcgcttcg
cgatacgttcgaacttctcttccaaggttcagaatgggagagaactcgatcccgaaggag
gcggcttatcagatcataaacgacgagctgatgctggacggaaatccacggctgaacctg
gcgtcgttcgtgacgacgtggatggagccggaatgcgataaactcattatgtcctccatc
aacaagaactacgtcgatatggatgagtaccctgtcaccactgagctccagaatcggtgc
gtgaacatgatagctcatctattcaatgcaccactcggagaatcagaggcggccgttgga
gtcggcacagtgggatcttccgaggccatcatgttggccggattggcattcaagaggagg
tggcagaacaagaggagagctgaggggaaaccggtcgacaagcccaacattgtcaccgga
gctaatgttcaggtgtgctgggagaaatttgcaaggtactttgaggtggagttgaaggag
gtgaagttgagggatgattactacgtaatggaccccgagaaagctgtggagatggttgat
gagaacaccatctgcgttgctgctatcctcggttccactcttaatggcgagttcgaagac
gtcaagcgcttgaatgatctcctggttgagaaaaaccaggaaactggatgggatactccg
atccatgtagacgccgcgagtggtgggttcattgctccgtttttatacccagaactcgag
tgggatttccgtttgccgctggtgaagagcatcaacgtgagcgggcacaagtacggactt
gtgtatgccggaattgggtgggtcatttggaggaacaaagaggacttgcctgaggagctc
atcttccatatcaactaccttggagcagatcaacctaccttcaccctcaatttctctaaa
ggatccagccaagttattgctcagtattaccaactaattcgcttgggttttgagggatac
aggaacatcatggaaaattgtcgtgaaaatatgattgtactaagagaaggactcgagaag
acaggtcgcttcaagatcgtctccaaggacgagggagtacctctggtggctttttctctc
aaagataaccactgccacgatgagtttgagatctctgatttgttgcgtcgctacgggtgg
attgtgccagcatacactatgccggcagatgctcagcatgtcaccgtgctgcgtgtggtc
atcagagaagacttttctcacactcttgctgagcgcctggtcaatgacatccagaaagtt
ctgcatgagctcgaccaccttccatcaaagctcagctccaacagttccattgaaagccaa
tcggttgagaataatgagaagtccaccgttaccacgaagaagagtgctttggagacacag
agggaaatcactaccatttggaggaagtttgttatggagaagaagaagataaccggtgtt
tgttag

KEGG   Rosa chinensis (China rose): 112199054Help
Entry
112199054         CDS       T06020                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00250  Alanine, aspartate and glutamate metabolism
rcn00410  beta-Alanine metabolism
rcn00430  Taurine and hypotaurine metabolism
rcn00650  Butanoate metabolism
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
Module
rcn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112199054
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112199054
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112199054
   00430 Taurine and hypotaurine metabolism
    112199054
Enzymes [BR:rcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112199054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 112199054
NCBI-ProteinID: XP_024195886
Position
4
AA seq 446 aa AA seqDB search
MEGAHSLHKHAASADAEPSPLKPSNIYVKNMNATCNFKSALTSLCSSAVPLQKMQLLDIT
FKNRCVNMMADLFNAPHKESDEAATGTGTVGSSEAILLAGLAFKRKWQNKRKAEGKPYDR
PNIVTGANVQVCWEKFARYFEVELKEVKVTEDYYVMDPVKAVELEDENTICVAAILGSTY
NGEFEDVKLLNDLSLEKNKQTGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVS
GHKYGLVYAGVGWIIWRSKEDLAEDLIFHMNYLGADQPTFTLNFSKGSSQIIAQYYQLIR
QGFEGYRNIMENCHNNAMVLKAGLEKTERFKILSKDIGVPVVAFSLKDRSHYDEYMVSEH
LRRFGWIVPAYSMPEDAKHVALLRVVIREDFSRTLAERLVLDITHVLKELDKLPLPSVSP
NGGDDQVCINGGIWKHEHFGGEKEIF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggctcattctttgcataaacacgcagcttctgctgatgccgaaccctctcca
ctgaagccaagcaacatttacgtgaagaatatgaatgccacttgcaacttcaagtctgca
ttgacatctctgtgtagctctgcagtccctctacagaaaatgcagcttcttgacattact
ttcaagaatcggtgcgtgaacatgatggcagatcttttcaatgcaccacataaagagtct
gatgaggctgccaccggaaccggaacagtcgggtcatcggaggccatcctgctggcaggt
ctcgcattcaagaggaagtggcagaataagaggaaggctgaaggaaaaccctatgacagg
cccaacatcgttactggtgccaatgtgcaggtatgctgggagaaatttgctaggtatttt
gaagtagaactgaaggaagtgaaggtgacggaagactattatgtaatggaccctgtgaaa
gctgtggaattggaagatgaaaacaccatctgcgttgctgctatcttgggttcaacttac
aatggagagttcgaagatgtcaagctcttgaatgatctttcgctagagaagaataagcaa
actggatgggataccccaattcatgtcgatgccgctagtggtggattcatagcgccattc
ttgtatcccgagttagaatgggatttccgtcttccactggtgaagagcatcaatgtgagt
ggtcataaatatggtcttgtgtatgctggagttgggtggatcatttggaggtccaaagaa
gacttggccgaagacctaatttttcacatgaattatctgggagctgatcaacccaccttc
accctcaatttctctaaagggtcgagtcaaatcattgctcaatactatcaacttatccga
cagggttttgagggataccgcaacatcatggaaaactgtcacaacaatgccatggtgttg
aaggcagggctggaaaagacagagcgcttcaaaatcttgtcgaaggacatcggggttcca
gtggtggccttttctttgaaagacagaagccactacgatgagtacatggtgtctgagcat
ttgcgtcgttttggctggattgtgccggcatattctatgccggaggatgctaagcacgtt
gcgttgctccgtgttgtgataagggaagacttctctcgcactctagctgagcgtcttgtg
ctcgacatcacccatgtcttgaaagagctcgacaaactgccgctgccatcagtcagtcca
aatggtggtgatgaccaagtgtgtattaatggcggcatatggaaacatgaacactttggt
ggcgaaaaagaaattttctga

KEGG   Rosa chinensis (China rose): 112200254Help
Entry
112200254         CDS       T06020                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00250  Alanine, aspartate and glutamate metabolism
rcn00410  beta-Alanine metabolism
rcn00430  Taurine and hypotaurine metabolism
rcn00650  Butanoate metabolism
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
Module
rcn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112200254
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112200254
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112200254
   00430 Taurine and hypotaurine metabolism
    112200254
Enzymes [BR:rcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112200254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 112200254
NCBI-ProteinID: XP_024197051
Position
4
AA seq 500 aa AA seqDB search
MGLSKTFSASDVSVHSTFASRYIRDKPAKYKMPENSTPKEVAYQVISDELMLDGKPRLNL
ASFVTTWMEPECDKLIMDSMNKNYVDMDEYPVTTELQNRCVNMIADLFNAPHKESDEAAT
GTGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDRPNIVTGANVQVCWEKFARYFEVELK
EVKVTEDYYVMDPVKAVELVDENTICVAAILGSTYNGEFEDVKLLNDLLLEKNKQTGWDT
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWIIWRSKEDLPED
LIFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRQGFEGYRNIMENCHNNAMVLKAGLE
KTERFKILSKDIGVPVVAFSLKDRSHYDEYMVSEHLRRFGWIVPAYSMPEDAKHVALLRV
VIREDFSRTLAERLVLDITHVLKELDKLPLPSVSPNGGDDQVCINGGICNGNMNTLVAKK
KFSDIDLKEEDCIPKLAKSA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctctcaaagacattctctgcttcggatgtgtctgtccactccacctttgcctct
cgctatatccgagacaagcccgctaagtacaagatgccggagaattcgacaccaaaggag
gtggcgtaccaggtgatcagtgacgagctgatgcttgatgggaagccaaggctgaacttg
gcgtcgtttgtgacgacatggatggagccagagtgtgataagctcatcatggactccatg
aacaagaactacgtcgacatggatgagtaccctgtcacaactgagcttcagaatcggtgc
gtgaacatgatagcagatcttttcaatgcaccacataaagagtctgatgaggctgccacc
ggaaccggaacagtcgggtcatcggaggccatcatgctggcaggtctcgcattcaagagg
aagtggcagaataagaggaaggctgaaggaaaaccctatgacaggcccaacatcgttact
ggtgccaatgtgcaggtatgctgggagaaatttgctaggtattttgaagtagaactgaag
gaagtgaaggtgacggaagactattatgtaatggaccctgtgaaagctgtggaattggta
gatgaaaacaccatctgcgttgctgctatcttgggttcaacttacaatggagagttcgaa
gatgtcaagctcttgaatgatcttttgctagagaagaataagcaaactggatgggatacc
ccaattcatgtcgatgctgctagtggtggattcatagcgccattcttgtatcccgagtta
gaatgggatttccgtcttccactggtgaagagcatcaatgtgagtggtcataaatatggt
cttgtgtatgctggagttgggtggatcatttggaggtccaaagaagacttgcccgaagac
ctaatttttcacatcaattatctgggagctgatcaacccaccttcaccctcaatttctct
aaagggtcgagtcaaatcattgctcaatactatcaacttatccgacagggttttgaggga
taccgcaacatcatggaaaactgtcacaacaatgccatggtgttgaaggcagggctggaa
aagacagagcgcttcaaaatcttgtcgaaggacatcggggttccagtggtggccttttct
ttgaaagacagaagccactacgatgagtacatggtgtctgagcatttgcgtcgttttggc
tggattgtgccggcatattctatgccggaggatgctaagcacgttgcgttgctccgtgtt
gtgataagggaagacttctctcgcactctagctgagcgtcttgtgctcgacatcacccat
gtcttgaaagagctcgacaaactgccgctgccatcagtcagtccaaatggtggtgatgac
caagtgtgtattaatggcggcatatgcaatggaaacatgaacactttggtggcgaaaaag
aaattttctgatattgatttaaaggaagaggattgcatccctaaactggcgaagagtgct
taa

DBGET integrated database retrieval system