KEGG   Rosa chinensis (China rose): 112179255Help
Entry
112179255         CDS       T06020                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390
Organism
rcn  Rosa chinensis (China rose)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase S_locus_glycop PAN_2 B_lectin DUF3403 Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 112179255
NCBI-ProteinID: XP_024173386
Position
7
AA seq 753 aa AA seqDB search
MQLDTLATLSIGSNGNLELVDGKQSSVWSANISNCSSAVLLDNGNFIVKDGMGADLWVSF
NDPSDTHLPRMLLGYDSGSGKRNFLTSWKSENDPSPGLFLVGLSEELPAQLYIWTNGSTP
HWRSGPWDKSRFIGIPTSNSDTSPYLNPWTLVDNVPQGTRYLSYSFDKIPGANVFTYADI
SSEGILRFLFSEIGKNWYLAWKSWNNPCDNYGACGPFGVCKAYESPICKCLKGFIPKSNK
EWSKRNWTGGCVRRRNLSCETNTNESISSKGKDGFSKLERLKLPNFHEYLGSVALDKFED
CKTRCLSNCSCLAYAYVDNIGCLVWFKDLFDMQQFTAFGEDLYVRLAHSELVEGKPTKLI
ASLTTIGFLSILVAIIFCLHRWRANQKRHVELIARRLESTSRIQIHRDGLRDYIGKHDFS
ELKIYDFDNILIATDNFSITNKLGQGGFGPVYKGMLPEGMEIAVKRLSSSSRQGVEEFKN
EMRLISNLQHKNLVRMMGCCVKEDEKLLIYEFMANKSLDTFLYDPTKRAMLNWATRFNII
QGVARGLLYLHHDSYVKVIHRDLKVSNILLDEKMNPKISDFGLARIVEETHSLDNTQKVV
GTRGYMSPEYAMGGIFSEKSDVYSFGVLVLEIISGKKNVSFYCYDQQLGFLAYVWKLWNE
GRALELVDEVLGDSYSSSEVMTCVHVGLLCVQDNAPDRPTMTDVASILSSEKDGPHPKRP
VFTIQNSVYHLGSSYENTNSSINEASITMIGGR
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgcaactagacaccttggctactttgagcattggcagcaatgggaatctggagctcgta
gatgggaaacagagttctgtctggtcagccaatatatctaattgttcatcagcagttctc
ttagataatggaaacttcattgtcaaagatggtatgggagctgatttgtgggtgagtttc
aatgatcctagtgacacacatctgccaagaatgttgctgggatatgatagcggttctgga
aaacggaatttcttgacatcttggaaaagtgaaaatgatccatcaccaggcctattcttg
gttggactgtcagaagagttaccggcacaattgtatatttggactaatggatctactccc
cactggagaagtgggccatgggataaatcaaggtttattggtatacccacatcgaattct
gacacttctccgtatctaaatccatggactcttgttgataatgtgccccagggaacaagg
tatttatcttacagttttgacaaaattcctggtgcgaatgtttttacatatgctgacata
tcttccgaaggtatactgaggtttttgttttcagaaattggcaagaactggtatcttgcg
tggaagtcatggaacaacccatgcgataattatggcgcctgtggaccttttggggtttgc
aaagcttatgaatctcctatctgcaagtgtttgaaagggtttatacccaagtcaaataag
gaatggagtaaaagaaactggaccggaggttgtgtgagacgaaggaacttgtcttgtgag
accaacacaaatgaatcaatctcatcaaaaggaaaagatgggttttcgaagttggaaaga
ttgaaattacccaattttcatgaatatttgggttctgtggctctagacaagttcgaggac
tgcaagacacggtgcctgagtaattgttcttgcctggcttatgcttatgttgataacata
gggtgtttggtgtggttcaaagacctttttgatatgcagcagtttacagcttttggagaa
gatctttacgttcgcctagcacactcagaactagttgaaggaaagccgacaaagttaatt
gcaagccttacaactattggatttttgagcatcttggttgctataatcttctgtttgcac
aggtggcgtgctaaccaaaagcgacacgttgaattaatagcacgacgcttggaatcaact
agtaggattcagattcatagagacggtcttcgagattatataggaaagcatgatttctcg
gagctaaagatatatgattttgataacatactaatcgccacagacaacttcagcatcaca
aacaaacttgggcaaggaggctttggcccagtttataaggggatgctaccagaagggatg
gaaatagcagtaaaaagactatctagtagctcaagacaaggtgtcgaagagttcaagaat
gagatgcggttgatctccaatcttcaacacaaaaaccttgttaggatgatgggttgctgt
gttaaagaggatgagaagttactaatttacgagttcatggcaaacaaaagcttggatact
tttctatatgatccgacgaagagagcaatgcttaattgggctacacgctttaatattatt
cagggtgttgctagagggcttctttatctccatcatgattcctatgtgaaggtgatacat
agagatttaaaagtcagtaacattctcctagatgagaaaatgaatccaaaaatctcagat
tttggattggcgcgcatagttgaagaaacacatagtctagataatactcaaaaggttgtt
ggaacacgtggctatatgtctccagagtatgccatgggtgggatattttctgaaaaatct
gatgtctacagcttcggggtcctggtgttagagattattagcggtaagaagaatgtcagc
ttctattgctatgaccaacaactaggcttccttgcctatgtatggaagttatggaatgaa
ggcagggcattggagttagtagatgaagtattgggtgattcatattcctcatccgaagta
atgacatgcgtgcatgttgggcttctttgtgtacaagacaatgctccggatagaccaacc
atgacagatgtagcttcaattctaagtagcgagaaagatggtccacatccaaagaggcct
gtattcactatccaaaactcagtttatcatcttggatcatcctatgaaaatacaaattcc
tccataaatgaagctagcattacaatgattggaggacgttaa

DBGET integrated database retrieval system