KEGG   Rosa chinensis (China rose): 112179297Help
Entry
112179297         CDS       T06020                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL15
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112179297
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112179297
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112179297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 112179297
NCBI-ProteinID: XP_024173445
Position
7
AA seq 426 aa AA seqDB search
MRPQPSSKPWRPFTAKYCCSAEDQTFFGNFSRPCRPSRSDLSRDGPQLPSFRRLSFSDLS
RSSSTRIMDDLAQSFGSELHDFQLSELRGITHDFSSNFLLGEGGFGTVHKGYIDENLRQG
LKPQAVAVKLLDIEGLQGHREWLAEVIFLGQLRHPHLVKLIGYCCEDEERLLVYEFMSRG
SLENHLFKRLSTSLPWGTRIKIAIGAAKGLAFLHDAEKPVIYRDFKTSNVLLDSDFTAKL
SDFGLAKMGPEGSETHVTTRVMGTYGYAAPEYVSTGQLTTKCDIYSFGVVLLELLTGRRA
MDKSRPKSEQNLIDWAKPYLTSTRRLRYIMDPRLAGQYSVKGAKEIALLALQCISLSPKD
RPRMPAIVETLEAVQLLKDMAVTHGHWPASPKSSRNGVFGAKARIDGNKVAYIRKSSSAT
TVTQKS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaggccacagccctcatcaaagccatggagaccattcacagcgaagtattgctgctcg
gctgaagaccagacattctttggcaatttcagcaggccctgcaggccttcgagatcagat
ttatcaagggatggtcctcagctaccctcgttccggcgactgtctttctctgatctcagt
cgttcttcctcgacgcgtatcatggatgatcttgcacagtctttcgggtctgagttgcat
gattttcagctgagtgagctgcgtggtataactcatgatttctcgagtaactttttgttg
ggggaaggtgggtttggaactgtgcataagggctatatagatgagaacttgaggcaaggt
ttgaagccacaagctgttgctgttaagctcctggacattgaaggcttgcagggacaccgc
gaatggctcgcagaagtgatatttcttgggcagctgaggcacccacatttggtcaaatta
attggctattgttgtgaggatgaagaaagacttctggtgtatgagtttatgtccagaggc
agcttggagaatcacttattcaaaaggctttcaacatcattgccatggggtacaagaata
aagatcgcaataggagcagccaaaggccttgctttcttgcatgatgccgagaagccagtc
atttatcgggatttcaaaacttcaaatgtcttgctagattctgattttacggcaaaactg
tcggatttcggacttgcaaagatgggacctgaaggatcagaaacacatgttacaacaaga
gtaatgggtacatatggctatgctgccccagaatacgtctctacagggcagttgacaaca
aaatgtgacatatacagctttggggtggtgctacttgaattgcttaccggaagaagagcc
atggacaaatcaagaccaaagagtgagcagaatctcattgattgggcaaaaccttacctc
acaagtactagaaggttacgctacattatggacccgaggcttgccggacagtattctgtg
aagggtgcaaaggagattgcccttctggcattacaatgcataagtttgagccctaaagac
aggccaaggatgccagctattgttgaaaccctagaagccgtgcaacttttgaaggacatg
gctgtgacacatgggcattggccggcgtcacccaaatctagtagaaatggggtttttggt
gctaaagctagaattgatggaaataaagttgcgtatatcaggaaatcctcttcagctaca
acagtaactcagaaatcttga

DBGET integrated database retrieval system