KEGG   Rosa chinensis (China rose): 112179355Help
Entry
112179355         CDS       T06020                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2
Organism
rcn  Rosa chinensis (China rose)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr WAK_assoc GUB_WAK_bind APH Kinase-like ABC1 Haspin_kinase Rax2 TMEM190 EphA2_TM
Motif
Other DBs
NCBI-GeneID: 112179355
NCBI-ProteinID: XP_024173522
Position
7
AA seq 662 aa AA seqDB search
MSSPISYLLAALLSLLLFNFHGSKAHFVPSTNCPIYNCGNDLKFHYPFWKIEDSTAGQYC
GYPGFGLNCSESGEPILSLPNNDSYHVKDINFIDSTITLVDIDVFDQQCPRARHSISVGT
LPLDYSPLDVNLSFYFNCTSFPDPVVPPIICLGIWGTKMSYVFTEGEQSDGFEWSESCEE
NVVVTVMKSKELHIDKLTGAFGGVMKQGFVLNWTTAKECASCESGGGLCGYNPTKADEFL
CFCKYSDGLCEKKGPKLSRRLKVVLGLCSVIGTIAVMCFIFFIWRRRNRNRYGPSSYASR
IIYSKSYSRSDTEKGSAYTGVHVFTYNELEQATNYFDSSKELGSGGFGRVYYGKVRDGRA
VAVKRLYETNCRRVEQFLNEIEILARLRHRNLVLLYGCTSRHSRELLLVYEYVPNGTLAD
HLHGGKAKPGALPWHTRINIAVETGSALSYLHASEIIHRDVKTTNILLDNNFCVKVADFG
LSRLFPTDVTHVSTAPQGTPGYVDPDYNQCYQLTMKSDVYSFGVVLVELISSLPAVDITR
HRQEINLSNMAINKIQKHALHELVNPSLGYESDFKVRKMINAVAELAFRCLQNETDMRPS
MVDVENELKRIQSDDFSKEKAEEIDISADDVVLLKSGPLPPSPDSVTINWVSMSSTPNDS
TA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacctatctcttatcttcttgcagctcttctctcactcttgttattcaacttt
catggaagcaaagcccactttgtaccctcaacaaattgccccatatacaattgtggtaat
gatctgaagtttcactaccctttttggaaaattgaagactccaccgccggtcaatactgt
ggttaccctggttttggtctcaattgctcagagtccggagagccaatactcagtctccca
aataatgactcctaccatgtgaaagacataaactttattgattccaccatcacccttgtt
gacatcgacgtcttcgatcaacaatgccctagggcaagacacagtattagtgtaggcacg
ctcccattggattactccccattggatgtgaacctgagcttctactttaactgcacttcc
tttcctgatcctgttgtgcctcccataatctgcttgggaatatggggtaccaaaatgtct
tatgttttcacggagggagagcaatcagatgggtttgaatggtctgaaagttgtgaggag
aatgtggtggtgactgtgatgaagagtaaggagcttcatattgataagttgactggtgct
tttggaggagttatgaagcaggggtttgtgcttaactggaccacggcgaaggagtgcgct
tcgtgtgaaagtggtggtggtttgtgtgggtacaaccccactaaagctgatgagtttctc
tgcttctgcaaatatagtgatggcctatgcgagaagaaaggccctaagctcagccggaga
ttgaaggttgtcttaggcctttgctcggttattggaactatagctgtaatgtgcttcatt
ttttttatatggcgacgccgcaacagaaatcgatatggtccatcatcctacgcatctcga
atcatctattctaaaagctattccagaagtgatactgagaagggaagtgcatacactgga
gttcatgtattcacctacaatgaacttgaacaagcaacaaactatttcgattcatctaaa
gaacttggtagtggaggctttggcagagtttactatggaaaagtccgtgatgggcgagca
gttgctgtcaagcgactatatgaaaccaattgcaggagagttgagcagttcctgaatgaa
attgagattttagctcgcctacgccaccgaaaccttgtgttactctatggatgcacctct
cgtcacagccgtgaactcctccttgtctacgaatatgttcccaatggaactcttgctgat
catcttcatggtggaaaagcaaaaccaggtgcactgccatggcatactcgaatcaacatt
gccgtagaaactggaagtgcattgtcctatcttcatgcgtctgagatcatccaccgtgac
gtgaaaaccactaacattcttcttgacaacaatttctgtgtcaaagtagcagattttgga
ctatctcgtctcttccccacggatgtcacccatgtatcaactgctccacaaggaactcca
ggttatgttgatcctgattataaccaatgctaccagcttactatgaagagtgatgtctat
agcttcggtgtggtcctggttgaactcatatcatccttgccagctgttgatatcacaagg
catcgacaggagatcaatttgtcaaacatggctatcaacaagattcagaaacatgcattg
catgagctagtgaatccatccctggggtatgaatcggactttaaagtaagaaaaatgatc
aatgcagtggcggaattagcgtttcggtgcctgcaaaatgagaccgacatgagaccttct
atggttgatgtggaaaatgaactaaagaggatacagagtgatgattttagtaaagaaaag
gcagaggaaattgatatttcagctgatgatgttgtgctgttaaagagtggtcctttgcca
ccttcaccagattctgtgacaataaattgggttagcatgtcttcaacaccaaatgatagc
actgcttaa

DBGET integrated database retrieval system