KEGG   Rosa chinensis (China rose): 112181548Help
Entry
112181548         CDS       T06020                                 

Definition
(RefSeq) receptor-like cytoplasmic kinase 176 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112181548
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112181548
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112181548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 112181548
NCBI-ProteinID: XP_024175687
Position
1
AA seq 410 aa AA seqDB search
MSGGLHNNPKGLPVNDPESTRIEGGAILQSFSLKIFCYNELKKATRNFRFKNIVGFGDSN
TVYKGCIDEHSLKATKPGTGIDITIKMPSRKERFRLQDHQDLLVTEFNRLGQLIHPNLVK
MIGYCLEDNNGLLVYEFMPRGSLGVHLHSRDPQSQPLSWNLRMKIALSAAKGLAFLHGDK
AKMIYGDFKPSNILLDSNYEAKIYGYGLVEDDELEGYRRLRGHDTECSLDSSYAAPEYLT
DTHRGEYEYRFESSDDDEMDDFVRLSPKSDVYSFGIVLLEMISGRQPLDNTKPMKERKLV
QWAKPYLTRRRKILKIIDDRIEGQYSKGGAIRAAKLVAQCLSLDPKGRPNMNDVVKALEQ
LQESSGMAGFGICEDEPSCRNQSRKYQSERQCNNCFLFQAICFRQPCIRY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcggacttcacaacaacccaaaggggctcccggttaatgacccagaaagtact
agaattgaagggggagctatattgcagtctttcagcttgaagatcttctgctataatgaa
ctgaaaaaggccaccaggaacttccgttttaaaaatattgtgggttttggtgattctaat
acagtctacaagggatgtattgatgagcattcactcaaggccaccaagcctggtaccggc
atagacatcaccataaagatgcctagcagaaaagagaggttccggctgcaggatcaccag
gacttgttggtgacagaatttaaccgccttggacagcttattcatccaaatcttgtaaaa
atgattggctactgtctagaggataacaatgggctcctggtgtatgaatttatgcctcga
ggcagcttgggagtacatctacattcaagggatcctcaatcacaaccgctttcatggaac
cttcgcatgaagattgcgcttagtgctgctaagggtctagcatttcttcacggtgacaag
gcaaaaatgatatacggggacttcaaaccttctaatattcttcttgattcaaactatgaa
gccaaaatctatggttatggcttggtagaggatgatgagcttgaaggttatagaaggctt
agaggccatgacactgaatgctctctggattcatcgtacgcagctcccgagtatcttacg
gacacacacagaggagaatatgagtacagatttgaaagcagcgatgatgatgaaatggat
gactttgttcgcttgagtcccaaaagtgatgtctacagttttgggattgttctgctcgaa
atgatatccggcagacaacctcttgacaatacgaagccaatgaaagagcgcaagttagtg
caatgggcgaagccttaccttaccagaagaagaaaaattctcaaaattattgatgatcgt
attgaaggccagtactccaaaggtggagctattagagcagctaagcttgtagctcaatgc
ttatcactagatcccaagggaaggccgaacatgaatgatgtggtaaaagcattggagcag
cttcaggaatccagtggcatggctggctttggaatttgtgaagatgaaccttcctgcaga
aatcaaagtaggaagtatcaatcagaaaggcaatgcaataactgcttcttattccaggca
atctgtttccggcagccatgcataagatattga

DBGET integrated database retrieval system