KEGG   Rosa chinensis (China rose): 112181668Help
Entry
112181668         CDS       T06020                                 

Definition
(RefSeq) serine/threonine-protein kinase PCRK1-like isoform X1
Organism
rcn  Rosa chinensis (China rose)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 112181668
NCBI-ProteinID: XP_024175819
Position
1
AA seq 718 aa AA seqDB search
MTAEAQKIVVIQDASKDIVSSSTIQLVLHGLSHKPGDELTLLAVLHQVNNPSTLSLMKAG
RLLGYRNKMDSSSFFGTNQKVIQEEIERKTEEYRNKVEITMISQICKCAEIKFHMEVLAG
PSPKMVAADAAKGLGATWVILDRQMKKDKQFFMENLTCGISRVKRNNSVEQLRGPKPIEN
SKPAAERRTTRRRIKEQVKYDEMIPGDEELSPKKTPSLPNISNGKEQDADVRGHPWPNYG
KSASSSNEQPTTSSLGTTEALPSVLAGHFQEVEITTNTGRGKAEVPPPIARVQASDQKET
DNAGSPDESKQHSYKNDWIGECQADEEFKNSTCTVCNNQRPKIGWKRDFTYAELQAATDG
FSTKNFLSEGGFGSVYKGELNGVKIAVKQHKNASFQGEKEFKSEVHVLSKARHENLVMLL
GSCSEGRQRLLVYEYVCNGSLDQHLSTHNTRPLSWDKKIKIATGAAKGLKYLHENNIIHR
DVRPNNVLVSHDYESLLGDFGLARTQHEDSDRSTDTTTVVGTLGYLAPEYAESGKVSTKT
DVYAFGVILLQLITGMRPTDKKLGGKSLVGWARPLLKERNYPDLIDPRNVDAHDVHQLYW
MVRVAEKCLSRDPYKRLTMDKVVYALDYLNEANQNCITGDFSPAHSESAGSRLGSSESHG
GQGDNYISIDITPEGGYMAGKLLPISPSPPSTCSETSCVSPVSEQSTLGSTASFEDKR
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagaagctcagaaaatagtggtgatccaggatgcatctaaagacatcgttagt
tcgagcacaattcaattagtcctgcatggcttatcacataagcctggggatgaacttaca
cttcttgcagttcttcaccaggttaataaccctagtacgttatctctcatgaaagctggg
agactgttgggatacaggaacaaaatggattccagttcattttttggaacaaaccagaaa
gtcattcaagaagagattgagaggaaaacggaggagtatcgtaacaaagtggaaattaca
atgatttctcagatatgtaaatgcgcagagattaagttccacatggaagtactcgctggc
ccgtctccaaagatggttgctgcagatgctgccaaaggattaggagcaacgtgggttatt
cttgataggcaaatgaagaaagacaagcaattcttcatggagaatttgacatgtggtata
tcgagggtgaagcgtaacaactctgttgaacaactgagaggcccaaaaccaattgagaac
agcaagccagcagctgaaaggcgcaccaccaggagacgtatcaaagaacaagtaaaatat
gatgaaatgatacccggagatgaagaactctctcctaaaaaaactccaagtcttccaaat
atcagtaatggcaaagaacaagatgctgatgttcgcggacacccatggcctaattatggg
aaatctgcttcctcatcaaatgagcagccaacaacttcaagccttgggactactgaagcc
ttaccttctgttcttgctggtcattttcaagaggtagaaatcactacaaatactggaaga
ggaaaggcagaagtccctcctccaattgcaagggttcaagcgagtgatcaaaaggaaaca
gataacgctgggagcccagatgaatctaaacagcacagctacaagaatgattggatagga
gaatgtcaagcagatgaggaatttaaaaattcaacctgcacagtttgcaataatcaacga
ccaaagatcggatggaagagagactttacttatgcagaactccaagctgctactgatggt
ttttccacaaagaacttcctatctgaaggtggatttggttcagtctacaaaggagaactg
aatggggtgaagattgctgtaaagcaacataaaaatgcaagcttccaaggagagaaagaa
tttaagtctgaagttcatgtactcagcaaagcaagacatgaaaatttggttatgctgtta
ggatcatgttcagaaggaagacagaggctccttgtttacgaatatgtttgcaacggttct
ttggatcaacatttatcaacacataacaccaggcctctcagttgggataagaagataaaa
atcgctactggagctgcaaaagggttaaaatatctgcatgagaacaacatcatccatagg
gacgtgagaccaaacaacgtcctcgtgtcacatgattatgaatccctgctaggagatttt
ggtcttgcaagaactcaacatgaagactcagatcgatcaacagacacaacaacagttgtc
ggaactttgggatatttggcaccagaatatgcagaaagtgggaaagtgtcaaccaagaca
gatgtttatgctttcggggtcattctattacagcttatcacaggaatgaggcctacagac
aagaagcttggagggaaaagtcttgtgggatgggcaagaccactattgaaagaaaggaat
tacccagatttaatcgacccaaggaatgtagatgcgcatgatgtgcatcaactctattgg
atggttcgggtagcagaaaaatgtctcagcagggatccttacaagagattaactatggat
aaggtagtttatgctttagattacctgaatgaagccaaccaaaattgtatcactggagac
ttctccccagcacattctgaatctgctggaagcagactgggctcttctgaatcacacggt
ggacaaggtgacaattacattagtatagacattactccagaaggaggctacatggccgga
aagctcttgccaatatcgccttcccctccatcaacatgttcagaaacgtcatgcgtttcc
ccagtgtcagagcaatccaccttgggtagcactgcaagttttgaagacaagagataa

DBGET integrated database retrieval system