KEGG   Rosa chinensis (China rose): 112181759Help
Entry
112181759         CDS       T06020                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
rcn  Rosa chinensis (China rose)
Brite
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112181759
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112181759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Pkinase_fungal PIP49_C Kinase-like
Motif
Other DBs
NCBI-GeneID: 112181759
NCBI-ProteinID: XP_024175927
Position
1
AA seq 651 aa AA seqDB search
MMSESRSSSTQAICFCNICFLIIFINFFSHFAHPLSFNINQFDQSANGVVFEGDAQFSSG
RIELNPGTYFDVGHAIYAEPLHLWDTATGSLADFTTHFTFMVDYGDEGWKFSDGIAFYLA
PVGYGIPPNSGGGELGLFNTTTNFNAKIVTVEFDSWGNEDWDPHPLRPHIGININEISSV
QYADWNPSNMTGKIGNAWITYNATANDLTVFWTFEQNTNPVFPGKSTSSITHNVDLRKVL
PERVTIGFSASAGLYLGRHFLCSWEFNSTLLDSDISRAESKGKKKKIFLILDIALPGFIL
MLGAVICWLMVLWNRRNNYSGEVSDLEKLAFPKRFAYQELFVATNGFADDRRLGQGGSGH
VYKGLIQDLGGCIVAVKRIFAEPDQHYERVFINEVKIISRLIHRNLVQFIGWCHEQGECL
LVYAYMRNNSLDTHIFGTRTTLQWQNRYKIALGLASAIHYLHEEAEQCVLHRDIKSANVL
LDEDFSTKLGDFGIAKLVDSRFRSQTREVAGTFGYMAPEYAIDGRASKESDIFSFGVVAL
EIACGRKTYQDGEYHLPLFRWVWQLFLAGNILDAADERLEMNYDRNEMKCLLIVGLWCTH
PNNKDRPKAGQVMEVIQHKAPLPELPYDMHNYPELPQPQYQFQTASSSSYI
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgaaagcagaagcagcagtacgcaagcaatctgcttctgcaatatttgcttc
ctaattattttcatcaatttcttctcccactttgctcatccactctccttcaacataaat
cagttcgaccagagtgcaaatggagttgtctttgaaggtgatgcccagttttcatcggga
aggattgagctcaacccaggcacttatttcgatgttggacatgctatttatgcagagcct
ttgcacctatgggacactgctactggatcactggcagacttcactactcatttcactttc
atggtcgactatggtgatgaagggtggaaattcagcgatggaattgccttttaccttgct
cctgttggctacggtattccacccaactctggcggtggtgaactgggattattcaacacc
accaccaattttaatgccaagattgtaaccgtagagttcgactcctggggaaacgaagac
tgggatccacatccactccggccccatattgggatcaacatcaatgaaatctcttcagtt
caatacgccgattggaatcccagtaacatgaccgggaagattggtaatgcatggataact
tataacgctactgccaacgaccttactgtgttttggacattcgagcaaaacacaaatccc
gtttttccaggcaaatctacttcttccattactcacaatgttgacttgcgaaaggttctc
cctgaaagggttacaattggtttttctgcttcggccggattatacctcgggcggcatttt
ttatgttcatgggagtttaattcgactttgttggatagcgatattagtagagccgaaagc
aagggaaagaagaaaaagatattcttgatactggacattgccctacctggcttcattttg
atgcttggtgcagtcatatgttggttgatggtattatggaatcggagaaacaattactcc
ggcgaagtctctgatcttgagaagctagcctttccaaaacgatttgcttaccaagaattg
tttgttgccaccaacgggtttgcagacgatagaaggctaggccaaggagggtcggggcat
gtatataaaggactcatacaagaccttggaggctgcatagttgccgtgaagagaatcttt
gcagaacctgatcagcattatgagagagtcttcatcaatgaagtcaaaatcataagccgc
ttaatccatcgaaacctagtgcagttcattgggtggtgtcatgagcaaggtgaatgctta
cttgtttatgcatatatgcgtaacaacagccttgacacccacatatttggcaccagaaca
accctgcaatggcaaaacaggtacaagatagctttggggttggcctcagcaattcactat
ctacatgaagaagcagagcaatgtgttcttcatagggatatcaaatcagctaacgtactg
ttggatgaagacttcagcactaagcttggtgattttggtattgctaagctcgtggattcc
cgcttcaggtctcagacaagagaggtggcagggacttttggatacatggcccctgaatat
gctattgatgggagggctagtaaggaatctgacatttttagttttggagttgtagccttg
gaaattgcttgcggaaggaagacttaccaagacggtgaatatcacttgccactctttagg
tgggtttggcagttgttccttgcaggaaatattctagacgcagctgatgaaagattagaa
atgaattatgatcgaaatgaaatgaaatgcttgttgattgttggactatggtgtactcac
cccaataacaaggatagacccaaagcaggacaggtgatggaggttattcagcataaagca
ccattgccggaacttccatatgacatgcataattatccagaactgcctcaacctcaatac
caatttcagactgcatcttcttctagctatatatag

DBGET integrated database retrieval system