KEGG   Rosa chinensis (China rose): 112181799Help
Entry
112181799         CDS       T06020                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112181799
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112181799
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112181799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like ABC1 YukC APH
Motif
Other DBs
NCBI-GeneID: 112181799
NCBI-ProteinID: XP_024175969
Position
1
AA seq 452 aa AA seqDB search
MSSQFDTTVDSDQKSFNSAINGAVAASVISTVVLIIAVTAIICAIINCVQKSGSSIPISA
KISSSNTDNDSNNKVAVDLRRVQFPVAFDSQAEFPTIKGFLSNMAREKPITYSAKQIAEF
THNYSYSNILGSGGFGVVYKGLLENGVQVAVKVLTNNNRAKIVEEQFMAEVGALGRTYHV
NLVRLYGFCFAPEMKALVYEYMENGSLDKLLFSDNGEVDLEKLHVIAVQTAKGLAYLHEE
CEQKIIHYDIKPENVLLDENLNPKVADFGLAKLCNRGSSRMLLTNFRGTAGYAAPEMWKP
YPVTHKCDVYSFGILLFEIVGRRRHCDDNVSESRDWLPKWTWNMFEKNDLATLLLRCGIE
ERDRGKAERMLMIALWCIQHSPEARPLMSNVVQMLEGHKEITPPPCPFEHVQSPQLNFSQ
NSGTDDNTSTSASATMIDPHPSVTHEIELVVE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaatttgacaccactgtcgacagtgaccagaaatctttcaattccgcaatc
aacggggctgttgctgcttctgttatttctactgtggtactgatcattgctgttacagcc
attatatgtgccattattaactgcgtgcaaaagtctggaagttctattccaatttctgcc
aagataagtagtagcaataccgacaacgattccaacaacaaagtagcagtggacttgaga
cgtgttcaatttccagtagcttttgattcccaggctgagtttccgacaatcaaagggttt
ctaagcaacatggcaagagagaagcctataacttactcagcgaagcaaattgcagaattc
acacataactatagctactctaacatattaggttcaggcggttttggagtagtatataaa
gggcttctcgaaaatggagtacaagtggctgtcaaggtccttacgaacaacaatagggct
aagatagttgaagagcagtttatggcagaagttggagccttgggaagaacttaccacgtc
aatttggttagactctatggcttctgcttcgcccccgaaatgaaagcccttgtctatgag
tacatggagaatggttctcttgacaagttattgttcagtgacaatggagaagtagattta
gagaagcttcatgttattgcagtccaaactgcaaaagggttggcttatttgcatgaggag
tgtgaacaaaagatcattcactatgatattaagcccgaaaatgtgcttctggatgagaac
ttgaatcccaaggttgcggattttggactcgccaagctttgcaatagagggagtagtcga
atgctcctaaccaatttcagagggacagctggatatgcagcgccagagatgtggaagcct
tatcctgtgactcacaaatgtgatgtttacagttttggtattcttctctttgagattgtt
ggaagaagaagacactgcgacgataatgtgagcgagtctcgagactggctacctaagtgg
acatggaacatgtttgagaaaaatgacttagcaacactgttattgcgctgtgggatcgaa
gagagagacaggggaaaagcagagaggatgttaatgatagctctgtggtgcattcagcat
tcaccagaagcaagacctctcatgagcaatgtagtgcaaatgttggaggggcataaagaa
attactccacctccttgcccctttgaacatgtgcaatctccgcaactaaatttcagtcaa
aatagtggaacagatgacaacactagtacttcggcatcagctacaatgattgatccacac
cctagtgtgacgcatgaaattgagctagttgtcgaatag

DBGET integrated database retrieval system