KEGG   Rosa chinensis (China rose): 112182525Help
Entry
112182525         CDS       T06020                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112182525
Enzymes [BR:rcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     112182525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 112182525
NCBI-ProteinID: XP_024176796
Position
1
AA seq 315 aa AA seqDB search
MSFCLSLTNPHITPLIAPIRPKSPRAVAGGSAMAANSLRVAAAQMTSINDLAANFATCSR
LVKEAAASGAKLICFPESFSFIGAKDGDSLKIAEPLEGPIMKQYCSLARESGIWLSLGGF
QEKGSDDEHLFNTHVVVDDAGNIRSTYRKIHLFDVDTPGGRSYKESSFTEAGKNVVAVDS
PVGRLGLTVCYDLRFPEIYQLLRFQHEAQILLVPSAFTKVTGQAHWEVLLRARAIETQCY
VIASAQAGKHNDKRESHGETLIIDPWGTVVGRLPDTLSTGITIADIDFSLIDSVRAKMPI
AKHRKPVEFWKSASL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcattttgtctctcactaaccaaccctcacattactccgctcattgctccgattcgt
cccaagtccccacgtgccgtcgccggcgggtcagccatggcggccaactcgctccgagtc
gccgccgcccagatgacctccatcaacgacctcgccgccaatttcgccacctgctcccgc
ctcgtcaaagaggcagctgctagtggagctaaattgatttgcttccctgaaagcttctcc
tttattggggctaaagatggggatagtctcaaaatagctgaacctttagagggtccaata
atgaaacagtactgctctcttgcaagggaatctgggatttggttgtcactaggtgggttt
caggaaaaggggtctgacgatgagcatttgtttaacacccatgttgtggtagatgatgct
ggcaacatcagaagcacttacagaaagattcacttgtttgatgtggatactcctggtggg
aggtcatacaaggaaagtagctttacagaagcagggaagaatgttgttgcagtagatagc
cctgtgggacgtttgggtttgacagtttgctatgacctgagattcccagagatttaccag
ctgctcaggttccaacatgaggcacagattctgttagttccttcagcctttaccaaagta
actggtcaggcacattgggaggttcttcttcgtgctcgtgcaattgagactcaatgttat
gtaatagcttctgcacaagctggaaagcataatgataaaagagagagccatggcgaaact
ttaattattgatccatggggaactgttgttggtcgactacctgatactttgtcaaccggg
attactatagctgatattgatttctcattgatcgattcagtgagagcaaagatgccaatt
gccaagcatcggaaacctgttgagttctggaaatctgcatctctatga

DBGET integrated database retrieval system